Protein Information |
|
|---|---|
| Protein Name | RNA-directed RNA polymerase NS5 |
| Accession Code | A0A142I5B9 |
| Gene | POLG |
| Organism | Zika virus ZIKV/Human/Cambodia/FSS13025/2010 (Taxonomy: 2316109) |
| Part of Reference Proteome? | No |
| Sequence (Length: 3423) | |
|
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEI IKKFKKDLAAMLRIINARKEKKRRGTDTSVGIVGLLLTTAMAVEVTRRGNAYYMYLDRSDAGEAISFPTTMGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVTLPSHSTRKLQTRSQTWLESREY TKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKVIYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGC VTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGK GSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDC EPRTGLDFSDLYYLTMNNKHWLVHKEWFHDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALA GALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQ TLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWD FGSVGGALNSLGKGIHQIFGAAFKSLFGGMSWFSQILIGTLLVWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGCSV DFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSRMENIMWRSVEGELNAILEENGVQL TVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGKSYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTS VWLKVREDYSLECDPAVIGTAAKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGIEESDLIIPKS LAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTRGPSLRSTTASGRVIEEWCCRECTMPPLSFRAK DGCWYGMEIRPRKEPESNLVRSMVTAGSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDL AKLAILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQTAISALEGDLMVPINGFAL AWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGLATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINV VGLLLLTRSGKRSWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKDAEVT GNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMAICGMNPIAIPFAAGAWYVYVKTGKRSGALWDVPAPKEVKKGET TDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLL AVPPGERARNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGRREEETPVEC FEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAPTRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIV DLMCHATFTSRLLQPIRVPNYNLYIMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEV EVPERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKTKHQEWDFVVTTDISEMGANF KADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQRRGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIY LQDGLIASLYRPEADKVAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIMEDSVPA EVWTRYGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPY KAAAAQLPETLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIP EPEKQRSPQDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPASAWAIYAALTTFIT PAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPLLMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAA ARAAQKRTAAGIMKNPVVDGIVVTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQMSALEFYSYKKSGITEVCREEA RRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGKVIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPMLVQSYG WNIVRLKSGVDVFHMAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMMETLERLQR RYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRPVKYEEDVNLGSGTRAVVSCAEAPNMKIIGN RIERIRSEHAETWFFDENHPYRTWAYHGSYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKV DTRVPDPQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAVEAVNDPRFWALVDKER EHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGARFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVL EEMSRIPGGRMYADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQDQ RGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHAL RFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHHFNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSY AQMWQLLYFHRRDLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKTPVTKWTDIPY LGKREDLWCGSLIGHRPRTTWAENIKNTVNMMRRIIGDEEKYVDYLSTQVRYLGEEGSTPGVL |
|
Structure Viewer (PDB: 6UTA) |
|---|
Description |
||
|---|---|---|
| [Capsid protein C]: Virion {By SimilarityUniProtKB:P17763}. Host nucleus {By SimilarityUniProtKB:P17763}. Host cytoplasm {By SimilarityUniProtKB:P06935}. Host cytoplasm, host perinuclear region {By SimilarityUniProtKB:P06935}. [Peptide pr]: Secreted {By SimilarityUniProtKB:P17763}. [Small envelope protein M]: Virion membrane {By SimilarityUniProtKB:P17763}; Multi-pass membrane protein {Sequence Analysis}. Host endoplasmic reticulum membrane {By SimilarityUniProtKB:P17763}; Multi-pass membrane protein {Sequence Analysis}. [Envelope protein E]: Virion membrane {By SimilarityUniProtKB:P17763}; Multi-pass membrane protein {Sequence Analysis}. Host endoplasmic reticulum membrane {By SimilarityUniProtKB:P17763}; Multi-pass membrane protein {Sequence Analysis}. Host cell surface {ECO:0000269|PubMed:33432092}. [Non-structural protein 1]: Secreted {By SimilarityUniProtKB:P17763}. Host endoplasmic reticulum membrane {ECO:0000250|UniProtKB:Q32ZE1}; Peripheral membrane protein {ECO:0000250|UniProtKB:Q32ZE1}; Lumenal side {By SimilarityUniProtKB:P17763}. Note=Located in RE-derived vesicles hosting the replication complex. {ECO:0000250|UniProtKB:Q9Q6P4}. [Non-structural protein 2A]: Host endoplasmic reticulum membrane {By SimilarityUniProtKB:P17763}; Multi-pass membrane protein {By SimilarityUniProtKB:P17763}. [Serine protease NS3]: Host endoplasmic reticulum membrane {Sequence Analysis|PROSITE-ProRule:PRU00860}; Peripheral membrane protein {Sequence Analysis|PROSITE-ProRule:PRU00860}; Cytoplasmic side {Sequence Analysis|PROSITE-ProRule:PRU00860}. Note=Remains non-covalently associated to serine protease subunit NS2B. {Sequence Analysis|PROSITE- ProRule:PRU00860}. [Non-structural protein 4A]: Host endoplasmic reticulum membrane {By SimilarityUniProtKB:P17763}; Multi-pass membrane protein {By SimilarityUniProtKB:P17763}. Note=Located in RE-associated vesicles hosting the replication complex. {By SimilarityUniProtKB:P17763}. [Non-structural protein 4B]: Host endoplasmic reticulum membrane {By SimilarityUniProtKB:P17763}; Multi-pass membrane protein {By SimilarityUniProtKB:P17763}. Note=Located in RE-derived vesicles hosting the replication complex. {ECO:0000250|UniProtKB:Q9Q6P4}. [RNA-directed RNA polymerase NS5]: Host endoplasmic reticulum membrane {ECO:0000250|UniProtKB:Q32ZE1}; Peripheral membrane protein {ECO:0000250|UniProtKB:Q32ZE1}; Cytoplasmic side {ECO:0000250|UniProtKB:Q32ZE1}. Host nucleus {By SimilarityUniProtKB:P17763}. Note=Located in RE-associated vesicles hosting the replication complex. NS5 protein is mainly localized in the nucleus rather than in ER vesicles. {By SimilarityUniProtKB:P17763}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Host Perinuclear Region | SL-0382 | The host perinuclear region is the host cytoplasmic region just around the host nucleus. Note: This location is defined for viral proteins that appear in the perinuclear region of infected host cells | Membrane Topology |
| Topology | Source | Annotation Type |
| Transmembrane | UniProt | Sequence Analysis {ECO:0000255} | Assigned Ontology terms |
| Cellular Component | Extracellular Region (GO:0005576) Host Cell Endoplasmic Reticulum Membrane (GO:0044167) Host Cell Nucleus (GO:0042025) Host Cell Perinuclear Region Of Cytoplasm (GO:0044220) Host Cell Surface (GO:0044228) Viral Capsid (GO:0019028) Virion Membrane (GO:0055036) |
|
Description |
|
|---|---|
| [Capsid protein C]: Plays a role in virus budding by binding to the cell membrane and gathering the viral RNA into a nucleocapsid that forms the core of the mature virus particle. During virus entry, may induce genome penetration into the host cytoplasm after hemifusion induced by the surface proteins. Can migrate to the cell nucleus where it modulates host functions. {By SimilarityUniProtKB:P17763}. [Capsid protein C]: Inhibits RNA silencing by interfering with host Dicer. {By SimilarityUniProtKB:P03314}. [Peptide pr]: Prevents premature fusion activity of envelope proteins in trans-Golgi by binding to envelope protein E at pH 6.0. After virion release in extracellular space, gets dissociated from E dimers. {By SimilarityUniProtKB:P17763}. [Protein prM]: Plays a role in host immune defense modulation and protection of envelope protein E during virion synthesis. PrM-E cleavage is inefficient, many virions are only partially matured and immature prM-E proteins could play a role in immune evasion. Contributes to fetal microcephaly in humans. Acts as a chaperone for envelope protein E during intracellular virion assembly by masking and inactivating envelope protein E fusion peptide. prM is the only viral peptide matured by host furin in the trans-Golgi network probably to avoid catastrophic activation of the viral fusion activity in acidic Golgi compartment prior to virion release. {By SimilarityUniProtKB:P17763}. [Small envelope protein M]: May play a role in virus budding. Exerts cytotoxic effects by activating a mitochondrial apoptotic pathway through M ectodomain. May display a viroporin activity. {By SimilarityUniProtKB:P17763}. [Envelope protein E]: Binds to host cell surface receptors and mediates fusion between viral and cellular membranes. Efficient virus attachment to cell is, at least in part, mediated by host HAVCR1 in a cell-type specific manner (PubMed:32641828). In addition, host NCAM1 can also be used as entry receptor (PubMed:32753727). Interaction with host HSPA5 plays an important role in the early stages of infection as well (PubMed:33432092). Envelope protein is synthesized in the endoplasmic reticulum and forms a heterodimer with protein prM. The heterodimer plays a role in virion budding in the ER, and the newly formed immature particle is covered with 60 spikes composed of heterodimers between precursor prM and envelope protein E. The virion is transported to the Golgi apparatus where the low pH causes the dissociation of PrM-E heterodimers and formation of E homodimers. PrM-E cleavage is inefficient, many virions are only partially matured and immature prM-E proteins could play a role in immune evasion (By similarity). {By SimilarityUniProtKB:P17763, Experimental EvidencePubMed:32641828, Experimental EvidencePubMed:32753727, Experimental EvidencePubMed:33432092}. [Non-structural protein 1]: Plays a role in the inhibition of host RLR-induced interferon-beta activation by targeting TANK-binding kinase 1/TBK1. In addition, recruits the host deubiquitinase USP8 to cleave 'Lys-11'-linked polyubiquitin chains from caspase-1/CASP1 thus inhibiting its proteasomal degradation. In turn, stabilized CASP1 promotes cleavage of cGAS, which inhibits its ability to recognize mitochondrial DNA release and initiate type I interferon signaling. {ECO:0000250|UniProtKB:Q32ZE1}. [Non-structural protein 2A]: Component of the viral RNA replication complex that recruits genomic RNA, the structural protein prM/E complex, and the NS2B/NS3 protease complex to the virion assembly site and orchestrates virus morphogenesis (PubMed:31662457). Antagonizes also the host alpha/beta interferon antiviral response (By similarity). May disrupt adherens junction formation and thereby impair proliferation of radial cells in the host cortex (By similarity). {ECO:0000250|UniProtKB:Q32ZE1, ECO:0000269|PubMed:31662457}. [Serine protease subunit NS2B]: Required cofactor for the serine protease function of NS3. {ECO:0000250|UniProtKB:Q32ZE1}. [Serine protease NS3]: Displays three enzymatic activities: serine protease, NTPase and RNA helicase. NS3 serine protease, in association with NS2B, performs its autocleavage and cleaves the polyprotein at dibasic sites in the cytoplasm: C-prM, NS2A-NS2B, NS2B- NS3, NS3-NS4A, NS4A-2K and NS4B-NS5. NS3 RNA helicase binds RNA and unwinds dsRNA in the 3' to 5' direction (By similarity). Leads to translation arrest when expressed ex vivo (By similarity). {ECO:0000250|UniProtKB:A0A024B7W1, ECO:0000250|UniProtKB:Q32ZE1}. [Non-structural protein 4A]: Regulates the ATPase activity of the NS3 helicase activity (By similarity). NS4A allows NS3 helicase to conserve energy during unwinding (By similarity). Cooperatively with NS4B suppresses the Akt-mTOR pathway and leads to cellular dysregulation (By similarity). By inhibiting host ANKLE2 functions, may cause defects in brain development, such as microcephaly (By similarity). Antagonizes also the host MDA5-mediated induction of alpha/beta interferon antiviral response (By similarity). Leads to translation arrest when expressed ex vivo (By similarity). {ECO:0000250|UniProtKB:A0A024B7W1, ECO:0000250|UniProtKB:Q32ZE1, ECO:0000250|UniProtKB:Q9Q6P4}. [Peptide 2k]: Functions as a signal peptide for NS4B and is required for the interferon antagonism activity of the latter. {By SimilarityUniProtKB:P17763}. [Non-structural protein 4B]: Induces the formation of ER- derived membrane vesicles where the viral replication takes place (By similarity). Also plays a role in the inhibition of host RLR-induced interferon-beta production at TANK-binding kinase 1/TBK1 level (By similarity). Cooperatively with NS4A suppresses the Akt-mTOR pathway and leads to cellular dysregulation (By similarity). {ECO:0000250|UniProtKB:Q32ZE1, ECO:0000250|UniProtKB:Q9Q6P4}. [RNA-directed RNA polymerase NS5]: Replicates the viral (+) and (-) RNA genome, and performs the capping of genomes in the cytoplasm (By similarity). Methylates viral RNA cap at guanine N-7 and ribose 2'-O positions. Once sufficient NS5 is expressed, binds to the cap-proximal structure and inhibits further translation of the viral genome (By similarity). Besides its role in RNA genome replication, also prevents the establishment of a cellular antiviral state by blocking the interferon-alpha/beta (IFN-alpha/beta) signaling pathway. Mechanistically, interferes with host kinases TBK1 and IKKE upstream of interferon regulatory factor 3/IRF3 to inhibit the RIG-I pathway (By similarity). Antagonizes also type I interferon signaling by targeting STAT2 for degradation by the proteasome thereby preventing activation of JAK-STAT signaling pathway (By similarity). Within the host nucleus, disrupts host SUMO1 and STAT2 co-localization with PML, resulting in PML degradation (By similarity). May also reduce immune responses by preventing the recruitment of the host PAF1 complex to interferon- responsive genes (By similarity). {ECO:0000250|UniProtKB:A0A024B7W1, ECO:0000250|UniProtKB:Q32ZE1}. | Assigned Ontology terms |
| Biological Process | Fusion Of Virus Membrane With Host Endosome Membrane (GO:0039654) Induction By Virus Of Host Autophagy (GO:0039520) Proteolysis (GO:0006508) Suppression By Virus Of Host JAK-STAT Cascade Via Inhibition Of STAT2 Activity (GO:0039564) Suppression By Virus Of Host Type I Interferon-Mediated Signaling Pathway (GO:0039502) Viral Entry Into Host Cell (GO:0046718) Viral RNA Genome Replication (GO:0039694) Virion Attachment To Host Cell (GO:0019062) |
| Molecular Function | ATP Binding (GO:0005524) ATP Hydrolysis Activity (GO:0016887) Double-Stranded RNA Binding (GO:0003725) GTP Binding (GO:0005525) Metal Ion Binding (GO:0046872) MRNA (Guanine-N7-)-Methyltransferase Activity (GO:0004482) MRNA (Nucleoside-2'-O-)-Methyltransferase Activity (GO:0004483) Protein Dimerization Activity (GO:0046983) RNA Helicase Activity (GO:0003724) RNA-Dependent RNA Polymerase Activity (GO:0003968) Serine-Type Endopeptidase Activity (GO:0004252) Structural Molecule Activity (GO:0005198) |
Interactions with Nuclear Envelope proteins (28 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| Q15633 | RISC-loading complex subunit TARBP2 | EBI-20625330 | 0.35 |
| Q5JTH9 | RRP12-like protein | EBI-20625330 | 0.35 |
| P63244 | Receptor of activated protein C kinase 1, N-terminally processed | EBI-20625330 | 0.35 |
| P57088 | Transmembrane protein 33 | EBI-20626314 | 0.35 |
| Q9NRG9 | Aladin | EBI-20626314 | 0.35 |
| O95831 | Apoptosis-inducing factor 1, mitochondrial | EBI-20625330 | 0.35 |
| Q9Y6K0 | Choline/ethanolaminephosphotransferase 1 | EBI-20626314 | 0.35 |
| Q07065 | Cytoskeleton-associated protein 4 | EBI-20626314 | 0.35 |
| Q9BV73 | Centrosome-associated protein CEP250 | EBI-20626135 | 0.35 |
| Q9UPY3 | Endoribonuclease Dicer | EBI-20625330 | 0.35 |
| P31689 | DnaJ homolog subfamily A member 1 | EBI-20625330 | 0.35 |
| Q15125 | 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase | EBI-20626314 | 0.35 |
| O14681 | Etoposide-induced protein 2.4 homolog | EBI-20626169 | 0.35 |
| O00165 | HCLS1-associated protein X-1 | EBI-20626314 | 0.35 |
| Q14974 | Importin subunit beta-1 | EBI-20625330 | 0.35 |
| Q86UE4 | Protein LYRIC | EBI-20625330 | 0.35 |
| Q9BTX1 | Nucleoporin NDC1 | EBI-20626314 | 0.35 |
| Q9NXE4 | Sphingomyelin phosphodiesterase 4 | EBI-20626314 | 0.35 |
| P57740 | Nuclear pore complex protein Nup107 | EBI-20625330 | 0.35 |
| Q8WUM0 | Nuclear pore complex protein Nup133 | EBI-20625330 | 0.35 |
| Q12769 | Nuclear pore complex protein Nup160 | EBI-20625330 | 0.35 |
| Q92621 | Nuclear pore complex protein Nup205 | EBI-20625330 | 0.35 |
| Q8NFH3 | Nucleoporin Nup43 | EBI-20625330 | 0.35 |
| Q9BW27 | Nuclear pore complex protein Nup85 | EBI-20625330 | 0.35 |
| Q8N1F7 | Nuclear pore complex protein Nup93 | EBI-20626314 | 0.35 |
| P52948 | Nuclear pore complex protein Nup96 | EBI-20625330 | 0.35 |
| Q8NC51 | Plasminogen activator inhibitor 1 RNA-binding protein | EBI-20625330 | 0.35 |
| O15173 | Membrane-associated progesterone receptor component 2 | EBI-20626314 | 0.35 | Interactions with other proteins (357 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| P35251 | Replication factor C subunit 1 (Activator 1 140 kDa subunit) (A1 140 kDa subunit) (Activator 1 large subunit) (Activator 1 subunit 1) (DNA-binding protein PO-GA) (Replication factor C 140 kDa subunit) (RF-C 140 kDa subunit) (RFC140) (Replication factor C large subunit) | EBI-20625330 | 0.35 |
| Q01105 | Protein SET (HLA-DR-associated protein II) (Inhibitor of granzyme A-activated DNase) (IGAAD) (PHAPII) (Phosphatase 2A inhibitor I2PP2A) (I-2PP2A) (Template-activating factor I) (TAF-I) | EBI-20625330 | 0.35 |
| Q9BSC4 | Nucleolar protein 10 | EBI-20625330 | 0.35 |
| Q7Z7F7 | 39S ribosomal protein L55, mitochondrial (L55mt) (MRP-L55) (Mitochondrial large ribosomal subunit protein bL31m) (Mitochondrial large ribosomal subunit protein mL55) | EBI-20625330 | 0.35 |
| Q6P161 | 39S ribosomal protein L54, mitochondrial (L54mt) (MRP-L54) (Mitochondrial large ribosomal subunit protein mL54) | EBI-20625330 | 0.35 |
| Q9NRX2 | 39S ribosomal protein L17, mitochondrial (L17mt) (MRP-L17) (LYST-interacting protein 2) (Mitochondrial large ribosomal subunit protein bL17m) | EBI-20625330 | 0.35 |
| Q9H5H4 | Zinc finger protein 768 | EBI-20625330 | 0.35 |
| Q9UEG4 | Zinc finger protein 629 (Zinc finger protein 65) | EBI-20625330 | 0.35 |
| Q969S3 | Cytoplasmic 60S subunit biogenesis factor ZNF622 (Zinc finger protein 622) (Zinc finger-like protein 9) | EBI-20625330 | 0.35 |
| Q96ME7 | Zinc finger protein 512 | EBI-20625330 | 0.35 |
| Q96KR1 | Zinc finger RNA-binding protein (hZFR) (M-phase phosphoprotein homolog) | EBI-20625330 | 0.35 |
| Q6NZY4 | Zinc finger CCHC domain-containing protein 8 (TRAMP-like complex RNA-binding factor ZCCHC8) | EBI-20625330 | 0.35 |
| Q7Z2W4 | Zinc finger CCCH-type antiviral protein 1 (ADP-ribosyltransferase diphtheria toxin-like 13) (ARTD13) (Inactive Poly [ADP-ribose] polymerase 13) (PARP13) (Zinc finger CCCH domain-containing protein 2) (Zinc finger antiviral protein) (ZAP) | EBI-20625330 | 0.35 |
| O43592 | Exportin-T (Exportin(tRNA)) (tRNA exportin) | EBI-20625330 | 0.35 |
| Q9H269 | Vacuolar protein sorting-associated protein 16 homolog (hVPS16) | EBI-20625330 | 0.35 |
| O15240 | Neurosecretory protein VGF [Cleaved into: Neuroendocrine regulatory peptide-1 (NERP-1); Neuroendocrine regulatory peptide-2 (NERP-2); VGF-derived peptide TLQP-21; VGF-derived peptide TLQP-62; Antimicrobial peptide VGF[554-577]] | EBI-20625330 | 0.35 |
| Q93008 | Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC 3.4.19.12) (Deubiquitinating enzyme FAF-X) (Fat facets in mammals) (hFAM) (Fat facets protein-related, X-linked) (Ubiquitin thioesterase FAF-X) (Ubiquitin-specific protease 9, X chromosome) (Ubiquitin-specific-processing protease FAF-X) | EBI-20625330 | 0.35 |
| Q13509 | Tubulin beta-3 chain (Tubulin beta-4 chain) (Tubulin beta-III) | EBI-20625330 | 0.35 |
| Q12899 | Tripartite motif-containing protein 26 (EC 2.3.2.27) (Acid finger protein) (AFP) (RING finger protein 95) (Zinc finger protein 173) | EBI-20625330 | 0.35 |
| P11387 | DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I) | EBI-20625330 | 0.35 |
| Q9UM00 | Calcium load-activated calcium channel (CLAC channel) (Transmembrane and coiled-coil domain-containing protein 1) (Transmembrane and coiled-coil domains protein 4) (Xenogeneic cross-immune protein PCIA3) | EBI-20625330 | 0.35 |
| O75683 | Surfeit locus protein 6 | EBI-20625330 | 0.35 |
| Q13243 | Serine/arginine-rich splicing factor 5 (Delayed-early protein HRS) (Pre-mRNA-splicing factor SRP40) (Splicing factor, arginine/serine-rich 5) | EBI-20625330 | 0.35 |
| Q9BXP5 | Serrate RNA effector molecule homolog (Arsenite-resistance protein 2) | EBI-20625330 | 0.35 |
| Q96SB4 | SRSF protein kinase 1 (EC 2.7.11.1) (SFRS protein kinase 1) (Serine/arginine-rich protein-specific kinase 1) (SR-protein-specific kinase 1) | EBI-20625330 | 0.35 |
| Q13501 | Sequestosome-1 (EBI3-associated protein of 60 kDa) (EBIAP) (p60) (Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa) (Ubiquitin-binding protein p62) | EBI-20625330 | 0.35 |
| Q16637 | Survival motor neuron protein (Component of gems 1) (Gemin-1) | EBI-20625330 | 0.50 |
| Q9NTJ3 | Structural maintenance of chromosomes protein 4 (SMC protein 4) (SMC-4) (Chromosome-associated polypeptide C) (hCAP-C) (XCAP-C homolog) | EBI-20625330 | 0.35 |
| O95347 | Structural maintenance of chromosomes protein 2 (SMC protein 2) (SMC-2) (Chromosome-associated protein E) (hCAP-E) (XCAP-E homolog) | EBI-20625330 | 0.35 |
| P53007 | Tricarboxylate transport protein, mitochondrial (Citrate transport protein) (CTP) (Mitochondrial citrate carrier) (CIC) (Solute carrier family 25 member 1) (Tricarboxylate carrier protein) | EBI-20625330 | 0.35 |
| Q9NVU7 | Protein SDA1 homolog (Nucleolar protein 130) (SDA1 domain-containing protein 1) (hSDA) | EBI-20625330 | 0.35 |
| O76021 | Ribosomal L1 domain-containing protein 1 (CATX-11) (Cellular senescence-inhibited gene protein) (Protein PBK1) | EBI-20625330 | 0.35 |
| Q14684 | Ribosomal RNA processing protein 1 homolog B (RRP1-like protein B) | EBI-20625330 | 0.35 |
| P08865 | 40S ribosomal protein SA (37 kDa laminin receptor precursor) (37LRP) (37/67 kDa laminin receptor) (LRP/LR) (67 kDa laminin receptor) (67LR) (Colon carcinoma laminin-binding protein) (Laminin receptor 1) (LamR) (Laminin-binding protein precursor p40) (LBP/p40) (Multidrug resistance-associated protein MGr1-Ag) (NEM/1CHD4) (Small ribosomal subunit protein uS2) | EBI-20625330 | 0.35 |
| P46781 | 40S ribosomal protein S9 (Small ribosomal subunit protein uS4) | EBI-20625330 | 0.35 |
| P62241 | 40S ribosomal protein S8 (Small ribosomal subunit protein eS8) | EBI-20625330 | 0.35 |
| P62081 | 40S ribosomal protein S7 (Small ribosomal subunit protein eS7) | EBI-20625330 | 0.35 |
| P62753 | 40S ribosomal protein S6 (Phosphoprotein NP33) (Small ribosomal subunit protein eS6) | EBI-20625330 | 0.35 |
| P46782 | 40S ribosomal protein S5 (Small ribosomal subunit protein uS7) [Cleaved into: 40S ribosomal protein S5, N-terminally processed] | EBI-20625330 | 0.35 |
| P62701 | 40S ribosomal protein S4, X isoform (SCR10) (Single copy abundant mRNA protein) (Small ribosomal subunit protein eS4) | EBI-20625330 | 0.35 |
| P61247 | 40S ribosomal protein S3a (Small ribosomal subunit protein eS1) (v-fos transformation effector protein) (Fte-1) | EBI-20625330 | 0.35 |
| P23396 | 40S ribosomal protein S3 (EC 4.2.99.18) (Small ribosomal subunit protein uS3) | EBI-20625330 | 0.35 |
| P62273 | 40S ribosomal protein S29 (Small ribosomal subunit protein uS14) | EBI-20625330 | 0.35 |
| P62857 | 40S ribosomal protein S28 (Small ribosomal subunit protein eS28) | EBI-20625330 | 0.35 |
| P62854 | 40S ribosomal protein S26 (Small ribosomal subunit protein eS26) | EBI-20625330 | 0.35 |
| P62851 | 40S ribosomal protein S25 (Small ribosomal subunit protein eS25) | EBI-20625330 | 0.35 |
| P62847 | 40S ribosomal protein S24 (Small ribosomal subunit protein eS24) | EBI-20625330 | 0.35 |
| P63220 | 40S ribosomal protein S21 (Small ribosomal subunit protein eS21) | EBI-20625330 | 0.35 |
| P60866 | 40S ribosomal protein S20 (Small ribosomal subunit protein uS10) | EBI-20625330 | 0.35 |
| P15880 | 40S ribosomal protein S2 (40S ribosomal protein S4) (Protein LLRep3) (Small ribosomal subunit protein uS5) | EBI-20625330 | 0.35 |
| P39019 | 40S ribosomal protein S19 (Small ribosomal subunit protein eS19) | EBI-20625330 | 0.35 |
| P62269 | 40S ribosomal protein S18 (Ke-3) (Ke3) (Small ribosomal subunit protein uS13) | EBI-20625330 | 0.35 |
| P08708 | 40S ribosomal protein S17 (Small ribosomal subunit protein eS17) | EBI-20625330 | 0.35 |
| P62249 | 40S ribosomal protein S16 (Small ribosomal subunit protein uS9) | EBI-20625330 | 0.35 |
| P62244 | 40S ribosomal protein S15a (Small ribosomal subunit protein uS8) | EBI-20625330 | 0.35 |
| P62841 | 40S ribosomal protein S15 (RIG protein) (Small ribosomal subunit protein uS19) | EBI-20625330 | 0.35 |
| P62277 | 40S ribosomal protein S13 (Small ribosomal subunit protein uS15) | EBI-20625330 | 0.35 |
| P25398 | 40S ribosomal protein S12 (Small ribosomal subunit protein eS12) | EBI-20625330 | 0.35 |
| P46783 | 40S ribosomal protein S10 (Small ribosomal subunit protein eS10) | EBI-20625330 | 0.35 |
| P04843 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit) (Ribophorin I) (RPN-I) (Ribophorin-1) | EBI-20625330 | 0.35 |
| P05387 | 60S acidic ribosomal protein P2 (Large ribosomal subunit protein P2) (Renal carcinoma antigen NY-REN-44) | EBI-20625330 | 0.35 |
| Q6FG99 | RPLP1 protein | EBI-20625330 | 0.35 |
| P05388 | 60S acidic ribosomal protein P0 (60S ribosomal protein L10E) (Large ribosomal subunit protein uL10) | EBI-20625330 | 0.35 |
| P32969 | 60S ribosomal protein L9 (Large ribosomal subunit protein uL6) | EBI-20625330 | 0.35 |
| P62917 | 60S ribosomal protein L8 (Large ribosomal subunit protein uL2) | EBI-20625330 | 0.35 |
| P62424 | 60S ribosomal protein L7a (Large ribosomal subunit protein eL8) (PLA-X polypeptide) (Surfeit locus protein 3) | EBI-20625330 | 0.35 |
| P18124 | 60S ribosomal protein L7 (Large ribosomal subunit protein uL30) | EBI-20625330 | 0.35 |
| Q02878 | 60S ribosomal protein L6 (Large ribosomal subunit protein eL6) (Neoplasm-related protein C140) (Tax-responsive enhancer element-binding protein 107) (TaxREB107) | EBI-20625330 | 0.35 |
| P46777 | 60S ribosomal protein L5 (Large ribosomal subunit protein uL18) | EBI-20625330 | 0.35 |
| P36578 | 60S ribosomal protein L4 (60S ribosomal protein L1) (Large ribosomal subunit protein uL4) | EBI-20625330 | 0.35 |
| P63173 | 60S ribosomal protein L38 (Large ribosomal subunit protein eL38) | EBI-20625330 | 0.35 |
| Q969Q0 | 60S ribosomal protein L36a-like (Large ribosomal subunit protein eL42-like) | EBI-20625330 | 0.35 |
| Q9Y3U8 | 60S ribosomal protein L36 (Large ribosomal subunit protein eL36) | EBI-20625330 | 0.35 |
| P18077 | 60S ribosomal protein L35a (Cell growth-inhibiting gene 33 protein) (Large ribosomal subunit protein eL33) | EBI-20625330 | 0.35 |
| P42766 | 60S ribosomal protein L35 (Large ribosomal subunit protein uL29) | EBI-20625330 | 0.35 |
| P49207 | 60S ribosomal protein L34 (Large ribosomal subunit protein eL34) | EBI-20625330 | 0.35 |
| P62910 | 60S ribosomal protein L32 (Large ribosomal subunit protein eL32) | EBI-20625330 | 0.35 |
| P62899 | 60S ribosomal protein L31 (Large ribosomal subunit protein eL31) | EBI-20625330 | 0.35 |
| P62888 | 60S ribosomal protein L30 (Large ribosomal subunit protein eL30) | EBI-20625330 | 0.35 |
| P39023 | 60S ribosomal protein L3 (HIV-1 TAR RNA-binding protein B) (TARBP-B) (Large ribosomal subunit protein uL3) | EBI-20625330 | 0.35 |
| P47914 | 60S ribosomal protein L29 (Cell surface heparin-binding protein HIP) (Large ribosomal subunit protein eL29) | EBI-20625330 | 0.35 |
| P46779 | 60S ribosomal protein L28 (Large ribosomal subunit protein eL28) | EBI-20625330 | 0.35 |
| P46776 | 60S ribosomal protein L27a (Large ribosomal subunit protein uL15) | EBI-20625330 | 0.35 |
| P61353 | 60S ribosomal protein L27 (Large ribosomal subunit protein eL27) | EBI-20625330 | 0.35 |
| Q9UNX3 | 60S ribosomal protein L26-like 1 (Large ribosomal subunit protein uL24-like 1) | EBI-20625330 | 0.35 |
| P61254 | 60S ribosomal protein L26 (Large ribosomal subunit protein uL24) | EBI-20625330 | 0.35 |
| P83731 | 60S ribosomal protein L24 (60S ribosomal protein L30) (Large ribosomal subunit protein eL24) | EBI-20625330 | 0.35 |
| P62750 | 60S ribosomal protein L23a (Large ribosomal subunit protein uL23) | EBI-20625330 | 0.35 |
| P62829 | 60S ribosomal protein L23 (60S ribosomal protein L17) (Large ribosomal subunit protein uL14) | EBI-20625330 | 0.35 |
| P35268 | 60S ribosomal protein L22 (EBER-associated protein) (EAP) (Epstein-Barr virus small RNA-associated protein) (Heparin-binding protein HBp15) (Large ribosomal subunit protein eL22) | EBI-20625330 | 0.35 |
| P46778 | 60S ribosomal protein L21 (Large ribosomal subunit protein eL21) | EBI-20625330 | 0.35 |
| P84098 | 60S ribosomal protein L19 (Large ribosomal subunit protein eL19) | EBI-20625330 | 0.35 |
| Q02543 | 60S ribosomal protein L18a (Large ribosomal subunit protein eL20) | EBI-20625330 | 0.35 |
| Q07020 | 60S ribosomal protein L18 (Large ribosomal subunit protein eL18) | EBI-20625330 | 0.35 |
| P18621 | 60S ribosomal protein L17 (60S ribosomal protein L23) (Large ribosomal subunit protein uL22) (PD-1) | EBI-20625330 | 0.35 |
| P61313 | 60S ribosomal protein L15 (Large ribosomal subunit protein eL15) | EBI-20625330 | 0.35 |
| P50914 | 60S ribosomal protein L14 (CAG-ISL 7) (Large ribosomal subunit protein eL14) | EBI-20625330 | 0.35 |
| P40429 | 60S ribosomal protein L13a (23 kDa highly basic protein) (Large ribosomal subunit protein uL13) | EBI-20625330 | 0.35 |
| P26373 | 60S ribosomal protein L13 (Breast basic conserved protein 1) (Large ribosomal subunit protein eL13) | EBI-20625330 | 0.35 |
| P30050 | 60S ribosomal protein L12 (Large ribosomal subunit protein uL11) | EBI-20625330 | 0.35 |
| P62913 | 60S ribosomal protein L11 (CLL-associated antigen KW-12) (Large ribosomal subunit protein uL5) | EBI-20625330 | 0.35 |
| P27635 | 60S ribosomal protein L10 (Laminin receptor homolog) (Large ribosomal subunit protein uL16) (Protein QM) (Ribosomal protein L10) (Tumor suppressor QM) | EBI-20625330 | 0.35 |
| Q14257 | Reticulocalbin-2 (Calcium-binding protein ERC-55) (E6-binding protein) (E6BP) | EBI-20625330 | 0.35 |
| P42696 | RNA-binding protein 34 (RNA-binding motif protein 34) | EBI-20625330 | 0.35 |
| Q9NW13 | RNA-binding protein 28 (RNA-binding motif protein 28) | EBI-20625330 | 0.35 |
| Q96EY7 | Pentatricopeptide repeat domain-containing protein 3, mitochondrial (28S ribosomal protein S39, mitochondrial) (MRP-S39) (Mitochondrial small ribosomal subunit protein mS39) (Transformation-related gene 15 protein) (TRG-15) | EBI-20625330 | 0.35 |
| P56730 | Neurotrypsin (EC 3.4.21.-) (Leydin) (Motopsin) (Serine protease 12) | EBI-20625330 | 0.35 |
| P78527 | DNA-dependent protein kinase catalytic subunit (DNA-PK catalytic subunit) (DNA-PKcs) (EC 2.7.11.1) (DNPK1) (p460) | EBI-20625330 | 0.35 |
| O15355 | Protein phosphatase 1G (EC 3.1.3.16) (Protein phosphatase 1C) (Protein phosphatase 2C isoform gamma) (PP2C-gamma) (Protein phosphatase magnesium-dependent 1 gamma) | EBI-20625330 | 0.35 |
| Q9NQ55 | Suppressor of SWI4 1 homolog (Ssf-1) (Brix domain-containing protein 3) (Peter Pan homolog) | EBI-20625330 | 0.35 |
| Q99575 | Ribonucleases P/MRP protein subunit POP1 (hPOP1) | EBI-20625330 | 0.35 |
| P40855 | Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein) | EBI-20625330 | 0.35 |
| O00408 | cGMP-dependent 3',5'-cyclic phosphodiesterase (EC 3.1.4.17) (Cyclic GMP-stimulated phosphodiesterase) (CGS-PDE) (cGSPDE) | EBI-20625330 | 0.35 |
| O00567 | Nucleolar protein 56 (Nucleolar protein 5A) | EBI-20625330 | 0.35 |
| Q9H6R4 | Nucleolar protein 6 (Nucleolar RNA-associated protein) (Nrap) | EBI-20625330 | 0.35 |
| Q9BYG3 | MKI67 FHA domain-interacting nucleolar phosphoprotein (Nucleolar phosphoprotein Nopp34) (Nucleolar protein interacting with the FHA domain of pKI-67) (hNIFK) | EBI-20625330 | 0.35 |
| Q8NEJ9 | Neuroguidin (Centromere accumulated nuclear protein 1) (CANu1) (EIF4E-binding protein) | EBI-20625330 | 0.50 |
| P19338 | Nucleolin (Protein C23) | EBI-20625330 | 0.35 |
| Q9H0A0 | RNA cytidine acetyltransferase (EC 2.3.1.-) (18S rRNA cytosine acetyltransferase) (N-acetyltransferase 10) (N-acetyltransferase-like protein) (hALP) | EBI-20625330 | 0.35 |
| Q99733 | Nucleosome assembly protein 1-like 4 (Nucleosome assembly protein 2) (NAP-2) | EBI-20625330 | 0.35 |
| F8W118 | Nucleosome assembly protein 1-like 1 | EBI-20625330 | 0.35 |
| P55209 | Nucleosome assembly protein 1-like 1 (NAP-1-related protein) (hNRP) | EBI-20625330 | 0.35 |
| Q9BQG0 | Myb-binding protein 1A | EBI-20625330 | 0.35 |
| P52701 | DNA mismatch repair protein Msh6 (hMSH6) (G/T mismatch-binding protein) (GTBP) (GTMBP) (MutS protein homolog 6) (MutS-alpha 160 kDa subunit) (p160) | EBI-20625330 | 0.35 |
| Q9UKD2 | mRNA turnover protein 4 homolog (Ribosome assembly factor MRTO4) | EBI-20625330 | 0.35 |
| P82933 | 28S ribosomal protein S9, mitochondrial (MRP-S9) (S9mt) (Mitochondrial small ribosomal subunit protein uS9m) | EBI-20625330 | 0.35 |
| Q9Y2R9 | 28S ribosomal protein S7, mitochondrial (MRP-S7) (S7mt) (Mitochondrial small ribosomal subunit protein uS7m) (bMRP-27a) (bMRP27a) | EBI-20625330 | 0.35 |
| P82932 | 28S ribosomal protein S6, mitochondrial (MRP-S6) (S6mt) (Mitochondrial small ribosomal subunit protein bS6m) | EBI-20625330 | 0.35 |
| P82675 | 28S ribosomal protein S5, mitochondrial (MRP-S5) (S5mt) (Mitochondrial small ribosomal subunit protein uS5m) | EBI-20625330 | 0.35 |
| P82673 | 28S ribosomal protein S35, mitochondrial (MRP-S35) (S35mt) (28S ribosomal protein S28, mitochondrial) (MRP-S28) (S28mt) (Mitochondrial small ribosomal subunit protein mS35) | EBI-20625330 | 0.35 |
| P82930 | 28S ribosomal protein S34, mitochondrial (MRP-S34) (S34mt) (Mitochondrial small ribosomal subunit protein mS34) | EBI-20625330 | 0.35 |
| Q9Y291 | 28S ribosomal protein S33, mitochondrial (MRP-S33) (S33mt) (Mitochondrial small ribosomal subunit protein mS33) | EBI-20625330 | 0.35 |
| Q92665 | 28S ribosomal protein S31, mitochondrial (MRP-S31) (S31mt) (Imogen 38) (Mitochondrial small ribosomal subunit protein mS31) | EBI-20625330 | 0.35 |
| Q9NP92 | 39S ribosomal protein S30, mitochondrial (MRP-S30) (S30mt) (Mitochondrial large ribosomal subunit protein mL65) (Mitochondrial large ribosomal subunit protein mS30) (Programmed cell death protein 9) | EBI-20625330 | 0.35 |
| Q9Y2Q9 | 28S ribosomal protein S28, mitochondrial (MRP-S28) (S28mt) (28S ribosomal protein S35, mitochondrial) (MRP-S35) (S35mt) (Mitochondrial small ribosomal subunit protein bS1m) | EBI-20625330 | 0.35 |
| Q92552 | 28S ribosomal protein S27, mitochondrial (MRP-S27) (S27mt) (Mitochondrial ribosomal protein S27) (Mitochondrial small ribosomal subunit protein mS27) | EBI-20625330 | 0.35 |
| Q9BYN8 | 28S ribosomal protein S26, mitochondrial (MRP-S26) (S26mt) (28S ribosomal protein S13, mitochondrial) (MRP-S13) (S13mt) (Mitochondrial small ribosomal subunit protein mS26) | EBI-20625330 | 0.35 |
| P82663 | 28S ribosomal protein S25, mitochondrial (MRP-S25) (S25mt) (Mitochondrial small ribosomal subunit protein mS25) | EBI-20625330 | 0.35 |
| Q9Y3D9 | 28S ribosomal protein S23, mitochondrial (MRP-S23) (S23mt) (Mitochondrial small ribosomal subunit protein mS23) | EBI-20625330 | 0.35 |
| P82650 | 28S ribosomal protein S22, mitochondrial (MRP-S22) (S22mt) (Mitochondrial small ribosomal subunit protein mS22) | EBI-20625330 | 0.35 |
| P82921 | 28S ribosomal protein S21, mitochondrial (MRP-S21) (S21mt) (Mitochondrial small ribosomal subunit protein bS21m) | EBI-20625330 | 0.35 |
| Q9Y399 | 28S ribosomal protein S2, mitochondrial (MRP-S2) (S2mt) (Mitochondrial small ribosomal subunit protein uS2m) | EBI-20625330 | 0.35 |
| Q9Y3D3 | 28S ribosomal protein S16, mitochondrial (MRP-S16) (S16mt) (Mitochondrial small ribosomal subunit protein bS16m) | EBI-20625330 | 0.35 |
| P82914 | 28S ribosomal protein S15, mitochondrial (MRP-S15) (S15mt) (Mitochondrial small ribosomal subunit protein uS15m) | EBI-20625330 | 0.35 |
| O60783 | 28S ribosomal protein S14, mitochondrial (MRP-S14) (S14mt) (Mitochondrial small ribosomal subunit protein uS14m) | EBI-20625330 | 0.35 |
| P82912 | 28S ribosomal protein S11, mitochondrial (MRP-S11) (S11mt) (Cervical cancer proto-oncogene 2 protein) (HCC-2) (Mitochondrial small ribosomal subunit protein uS11m) | EBI-20625330 | 0.35 |
| P82664 | 28S ribosomal protein S10, mitochondrial (MRP-S10) (S10mt) (Mitochondrial small ribosomal subunit protein uS10m) | EBI-20625330 | 0.35 |
| Q9BYD2 | 39S ribosomal protein L9, mitochondrial (L9mt) (MRP-L9) (Mitochondrial large ribosomal subunit protein bL9m) | EBI-20625330 | 0.35 |
| Q9HD33 | 39S ribosomal protein L47, mitochondrial (L47mt) (MRP-L47) (Mitochondrial large ribosomal subunit protein uL29m) (Nasopharyngeal carcinoma metastasis-related protein 1) | EBI-20625330 | 0.35 |
| Q9BRJ2 | 39S ribosomal protein L45, mitochondrial (L45mt) (MRP-L45) (Mitochondrial large ribosomal subunit protein mL45) | EBI-20625330 | 0.35 |
| Q9Y6G3 | 39S ribosomal protein L42, mitochondrial (L42mt) (MRP-L42) (39S ribosomal protein L31, mitochondrial) (L31mt) (MRP-L31) (Mitochondrial large ribosomal subunit protein mL42) | EBI-20625330 | 0.35 |
| Q8IXM3 | 39S ribosomal protein L41, mitochondrial (L41mt) (MRP-L41) (39S ribosomal protein L27 homolog) (Bcl-2-interacting mitochondrial ribosomal protein L41) (Cell proliferation-inducing gene 3 protein) (MRP-L27 homolog) (Mitochondrial large ribosomal subunit protein mL41) | EBI-20625330 | 0.35 |
| Q9NYK5 | 39S ribosomal protein L39, mitochondrial (L39mt) (MRP-L39) (39S ribosomal protein L5, mitochondrial) (L5mt) (MRP-L5) (Mitochondrial large ribosomal subunit protein mL39) | EBI-20625330 | 0.35 |
| Q96DV4 | 39S ribosomal protein L38, mitochondrial (L38mt) (MRP-L38) (Mitochondrial large ribosomal subunit protein mL38) | EBI-20625330 | 0.35 |
| Q9BZE1 | 39S ribosomal protein L37, mitochondrial (L37mt) (MRP-L37) (39S ribosomal protein L2, mitochondrial) (L2mt) (MRP-L2) (Mitochondrial large ribosomal subunit protein mL37) | EBI-20625330 | 0.35 |
| Q9NZE8 | 39S ribosomal protein L35, mitochondrial (L35mt) (MRP-L35) (Mitochondrial large ribosomal subunit protein bL35m) | EBI-20625330 | 0.35 |
| P09001 | 39S ribosomal protein L3, mitochondrial (L3mt) (MRP-L3) (Mitochondrial large ribosomal subunit protein uL3m) | EBI-20625330 | 0.35 |
| Q13084 | 39S ribosomal protein L28, mitochondrial (L28mt) (MRP-L28) (Melanoma antigen p15) (Melanoma-associated antigen recognized by T-lymphocytes) (Mitochondrial large ribosomal subunit protein bL28m) | EBI-20625330 | 0.35 |
| Q96A35 | 39S ribosomal protein L24, mitochondrial (L24mt) (MRP-L24) (Mitochondrial large ribosomal subunit protein uL24m) | EBI-20625330 | 0.35 |
| Q16540 | 39S ribosomal protein L23, mitochondrial (L23mt) (MRP-L23) (L23 mitochondrial-related protein) (Mitochondrial large ribosomal subunit protein uL23m) (Ribosomal protein L23-like) | EBI-20625330 | 0.35 |
| Q9NWU5 | 39S ribosomal protein L22, mitochondrial (L22mt) (MRP-L22) (39S ribosomal protein L25, mitochondrial) (L25mt) (MRP-L25) (Mitochondrial large ribosomal subunit protein uL22m) | EBI-20625330 | 0.35 |
| Q7Z2W9 | 39S ribosomal protein L21, mitochondrial (L21mt) (MRP-L21) (Mitochondrial large ribosomal subunit protein bL21m) | EBI-20625330 | 0.35 |
| Q5T653 | 39S ribosomal protein L2, mitochondrial (L2mt) (MRP-L2) (Mitochondrial large ribosomal subunit protein uL2m) | EBI-20625330 | 0.35 |
| P49406 | 39S ribosomal protein L19, mitochondrial (L19mt) (MRP-L19) (39S ribosomal protein L15, mitochondrial) (L15mt) (MRP-L15) (Mitochondrial large ribosomal subunit protein bL19m) | EBI-20625330 | 0.35 |
| Q9H0U6 | 39S ribosomal protein L18, mitochondrial (L18mt) (MRP-L18) (Mitochondrial large ribosomal subunit protein uL18m) | EBI-20625330 | 0.35 |
| Q9NX20 | 39S ribosomal protein L16, mitochondrial (L16mt) (MRP-L16) (Mitochondrial large ribosomal subunit protein uL16m) | EBI-20625330 | 0.35 |
| Q9BYD1 | 39S ribosomal protein L13, mitochondrial (L13mt) (MRP-L13) (Mitochondrial large ribosomal subunit protein uL13m) | EBI-20625330 | 0.35 |
| Q9Y3B7 | 39S ribosomal protein L11, mitochondrial (L11mt) (MRP-L11) (Mitochondrial large ribosomal subunit protein uL11m) | EBI-20625330 | 0.35 |
| Q7Z7H8 | 39S ribosomal protein L10, mitochondrial (L10mt) (MRP-L10) (39S ribosomal protein L8, mitochondrial) (L8mt) (MRP-L8) (Mitochondrial large ribosomal subunit protein uL10m) | EBI-20625330 | 0.35 |
| Q9BYD6 | 39S ribosomal protein L1, mitochondrial (L1mt) (MRP-L1) (Mitochondrial large ribosomal subunit protein uL1m) | EBI-20625330 | 0.35 |
| Q9Y5V3 | Melanoma-associated antigen D1 (MAGE tumor antigen CCF) (MAGE-D1 antigen) (Neurotrophin receptor-interacting MAGE homolog) | EBI-20625330 | 0.35 |
| Q9NX58 | Cell growth-regulating nucleolar protein | EBI-20625330 | 0.50 |
| Q9BRT6 | Protein LLP homolog (Protein LAPS18-like) | EBI-20625330 | 0.35 |
| Q4G0J3 | La-related protein 7 (La ribonucleoprotein domain family member 7) (hLARP7) (P-TEFb-interaction protein for 7SK stability) (PIP7S) | EBI-20625330 | 0.50 |
| Q6PKG0 | La-related protein 1 (La ribonucleoprotein domain family member 1) | EBI-20625330 | 0.35 |
| Q13601 | KRR1 small subunit processome component homolog (HIV-1 Rev-binding protein 2) (KRR-R motif-containing protein 1) (Rev-interacting protein 1) (Rip-1) | EBI-20625330 | 0.35 |
| Q8N9T8 | Protein KRI1 homolog | EBI-20625330 | 0.35 |
| Q15397 | Pumilio homolog 3 (HBV X-transactivated gene 5 protein) (HBV XAg-transactivated protein 5) (Minor histocompatibility antigen HA-8) (HLA-HA8) | EBI-20625330 | 0.35 |
| Q96P70 | Importin-9 (Imp9) (Ran-binding protein 9) (RanBP9) | EBI-20625330 | 0.35 |
| O95373 | Importin-7 (Imp7) (Ran-binding protein 7) (RanBP7) | EBI-20625330 | 0.35 |
| Q14197 | Peptidyl-tRNA hydrolase ICT1, mitochondrial (EC 3.1.1.29) (39S ribosomal protein L58, mitochondrial) (MRP-L58) (Digestion substraction 1) (DS-1) (Immature colon carcinoma transcript 1 protein) (Mitochondrial large ribosomal subunit protein mL62) | EBI-20625330 | 0.35 |
| Q5SSJ5 | Heterochromatin protein 1-binding protein 3 (Protein HP1-BP74) | EBI-20625330 | 0.35 |
| Q00341 | Vigilin (High density lipoprotein-binding protein) (HDL-binding protein) | EBI-20625330 | 0.35 |
| P55084 | Trifunctional enzyme subunit beta, mitochondrial (TP-beta) [Includes: 3-ketoacyl-CoA thiolase (EC 2.3.1.155) (EC 2.3.1.16) (Acetyl-CoA acyltransferase) (Beta-ketothiolase)] | EBI-20625330 | 0.35 |
| P40939 | Trifunctional enzyme subunit alpha, mitochondrial (78 kDa gastrin-binding protein) (Monolysocardiolipin acyltransferase) (EC 2.3.1.-) (TP-alpha) [Includes: Long-chain enoyl-CoA hydratase (EC 4.2.1.17); Long chain 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.211)] | EBI-20625330 | 0.35 |
| Q9P035 | Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 (EC 4.2.1.134) (3-hydroxyacyl-CoA dehydratase 3) (HACD3) (Butyrate-induced protein 1) (B-ind1) (hB-ind1) (Protein-tyrosine phosphatase-like A domain-containing protein 1) | EBI-20625330 | 0.35 |
| Q92522 | Histone H1.10 (Histone H1x) | EBI-20625330 | 0.35 |
| Q9BZE4 | GTP-binding protein 4 (Chronic renal failure gene protein) (GTP-binding protein NGB) (Nucleolar GTP-binding protein 1) | EBI-20625330 | 0.35 |
| Q8WUA4 | General transcription factor 3C polypeptide 2 (TF3C-beta) (Transcription factor IIIC 110 kDa subunit) (TFIIIC 110 kDa subunit) (TFIIIC110) (Transcription factor IIIC subunit beta) | EBI-20625330 | 0.35 |
| Q9BQ67 | Glutamate-rich WD repeat-containing protein 1 | EBI-20625330 | 0.35 |
| Q5JY77 | G-protein coupled receptor-associated sorting protein 1 (GASP-1) | EBI-20625330 | 0.35 |
| A0A024R2Z6 | Guanine nucleotide-binding protein-like 3 | EBI-20625330 | 0.35 |
| Q13823 | Nucleolar GTP-binding protein 2 (Autoantigen NGP-1) | EBI-20625330 | 0.35 |
| Q8WXD5 | Gem-associated protein 6 (Gemin-6) (SIP2) | EBI-20625330 | 0.35 |
| Q9HBB9 | HC56 | EBI-20625330 | 0.35 |
| Q8IY81 | pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 (EC 2.1.1.-) (Protein ftsJ homolog 3) (Putative rRNA methyltransferase 3) | EBI-20625330 | 0.35 |
| P62861 | FAU ubiquitin-like and ribosomal protein S30 [Cleaved into: Ubiquitin-like protein FUBI; 40S ribosomal protein S30 (Small ribosomal subunit protein eS30)] | EBI-20625330 | 0.35 |
| Q06265 | Exosome complex component RRP45 (Autoantigen PM/Scl 1) (Exosome component 9) (P75 polymyositis-scleroderma overlap syndrome-associated autoantigen) (Polymyositis/scleroderma autoantigen 1) (Polymyositis/scleroderma autoantigen 75 kDa) (PM/Scl-75) | EBI-20625330 | 0.35 |
| Q9NPD3 | Exosome complex component RRP41 (Exosome component 4) (Ribosomal RNA-processing protein 41) (p12A) | EBI-20625330 | 0.35 |
| Q01780 | Exosome component 10 (EC 3.1.13.-) (Autoantigen PM/Scl 2) (P100 polymyositis-scleroderma overlap syndrome-associated autoantigen) (Polymyositis/scleroderma autoantigen 100 kDa) (PM/Scl-100) (Polymyositis/scleroderma autoantigen 2) | EBI-20625330 | 0.35 |
| Q9Y3B2 | Exosome complex component CSL4 (Exosome component 1) | EBI-20625330 | 0.35 |
| O75616 | GTPase Era, mitochondrial (H-ERA) (hERA) (Conserved ERA-like GTPase) (CEGA) (ERA-W) (ERA-like protein 1) | EBI-20625330 | 0.35 |
| Q9NR50 | Translation initiation factor eIF-2B subunit gamma (eIF-2B GDP-GTP exchange factor subunit gamma) | EBI-20625330 | 0.35 |
| Q99848 | Probable rRNA-processing protein EBP2 (EBNA1-binding protein 2) (Nucleolar protein p40) | EBI-20625330 | 0.35 |
| Q8WXX5 | DnaJ homolog subfamily C member 9 (HDJC9) (DnaJ protein SB73) | EBI-20625330 | 0.35 |
| O60884 | DnaJ homolog subfamily A member 2 (Cell cycle progression restoration gene 3 protein) (Dnj3) (Dj3) (HIRA-interacting protein 4) (Renal carcinoma antigen NY-REN-14) | EBI-20625330 | 0.35 |
| O60832 | H/ACA ribonucleoprotein complex subunit DKC1 (EC 5.4.99.-) (CBF5 homolog) (Dyskerin) (Nopp140-associated protein of 57 kDa) (Nucleolar protein NAP57) (Nucleolar protein family A member 4) (snoRNP protein DKC1) | EBI-20625330 | 0.35 |
| Q9UNQ2 | Probable dimethyladenosine transferase (EC 2.1.1.183) (DIM1 dimethyladenosine transferase 1 homolog) (DIM1 dimethyladenosine transferase 1-like) (Probable 18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase) (Probable 18S rRNA dimethylase) (Probable S-adenosylmethionine-6-N',N'-adenosyl(rRNA) dimethyltransferase) | EBI-20625330 | 0.35 |
| Q6P158 | Putative ATP-dependent RNA helicase DHX57 (EC 3.6.4.13) (DEAH box protein 57) | EBI-20625330 | 0.35 |
| Q9BQ39 | ATP-dependent RNA helicase DDX50 (EC 3.6.4.13) (DEAD box protein 50) (Gu-beta) (Nucleolar protein Gu2) | EBI-20625330 | 0.35 |
| O15523 | ATP-dependent RNA helicase DDX3Y (EC 3.6.4.13) (DEAD box protein 3, Y-chromosomal) | EBI-20625330 | 0.35 |
| Q9GZR7 | ATP-dependent RNA helicase DDX24 (EC 3.6.4.13) (DEAD box protein 24) | EBI-20625330 | 0.35 |
| Q9NR30 | Nucleolar RNA helicase 2 (EC 3.6.4.13) (DEAD box protein 21) (Gu-alpha) (Nucleolar RNA helicase Gu) (Nucleolar RNA helicase II) (RH II/Gu) | EBI-20625330 | 0.35 |
| Q9UHI6 | Probable ATP-dependent RNA helicase DDX20 (EC 3.6.1.15) (EC 3.6.4.13) (Component of gems 3) (DEAD box protein 20) (DEAD box protein DP 103) (Gemin-3) | EBI-20625330 | 0.35 |
| Q9NVP1 | ATP-dependent RNA helicase DDX18 (EC 3.6.4.13) (DEAD box protein 18) (Myc-regulated DEAD box protein) (MrDb) | EBI-20625330 | 0.35 |
| Q13206 | Probable ATP-dependent RNA helicase DDX10 (EC 3.6.4.13) (DEAD box protein 10) | EBI-20625330 | 0.35 |
| Q16531 | DNA damage-binding protein 1 (DDB p127 subunit) (DNA damage-binding protein a) (DDBa) (Damage-specific DNA-binding protein 1) (HBV X-associated protein 1) (XAP-1) (UV-damaged DNA-binding factor) (UV-damaged DNA-binding protein 1) (UV-DDB 1) (XPE-binding factor) (XPE-BF) (Xeroderma pigmentosum group E-complementing protein) (XPCe) | EBI-20625330 | 0.35 |
| P51398 | 28S ribosomal protein S29, mitochondrial (MRP-S29) (S29mt) (Death-associated protein 3) (DAP-3) (Ionizing radiation resistance conferring protein) (Mitochondrial small ribosomal subunit protein mS29) | EBI-20625330 | 0.35 |
| Q9BQ75 | Protein CMSS1 (Cms1 ribosomal small subunit homolog) | EBI-20625330 | 0.35 |
| B2R5U7 | cDNA, FLJ92633, highly similar to Homo sapiens CCAAT-box-binding transcription factor (CBF2), mRNA | EBI-20625330 | 0.35 |
| Q6PK04 | Coiled-coil domain-containing protein 137 | EBI-20625330 | 0.35 |
| Q13555 | Calcium/calmodulin-dependent protein kinase type II subunit gamma (CaM kinase II subunit gamma) (CaMK-II subunit gamma) (EC 2.7.11.17) | EBI-20625330 | 0.35 |
| P62158 | Calmodulin-1 | EBI-20625330 | 0.35 |
| Q9BRJ6 | Uncharacterized protein C7orf50 | EBI-20625330 | 0.35 |
| Q8TDN6 | Ribosome biogenesis protein BRX1 homolog (Brix domain-containing protein 2) | EBI-20625330 | 0.35 |
| Q14137 | Ribosome biogenesis protein BOP1 (Block of proliferation 1 protein) | EBI-20625330 | 0.35 |
| Q14692 | Ribosome biogenesis protein BMS1 homolog (Ribosome assembly protein BMS1 homolog) | EBI-20625330 | 0.35 |
| P16615 | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2) (SR Ca(2+)-ATPase 2) (EC 7.2.2.10) (Calcium pump 2) (Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform) (Endoplasmic reticulum class 1/2 Ca(2+) ATPase) | EBI-20625330 | 0.35 |
| Q6NT76 | Homeobox-containing protein 1 (Homeobox telomere-binding protein 1) (Telomere-associated homeobox-containing protein 1) | EBI-20625829 | 0.40 |
| O60613 | Selenoprotein F (15 kDa selenoprotein) | EBI-20626156 | 0.35 |
| O14967 | Calmegin | EBI-20626156 | 0.35 |
| Q13315 | Serine-protein kinase ATM (EC 2.7.11.1) (Ataxia telangiectasia mutated) (A-T mutated) | EBI-20626076 | 0.35 |
| P04350 | Tubulin beta-4A chain (Tubulin 5 beta) (Tubulin beta-4 chain) | EBI-20626076 | 0.35 |
| Q9NZ01 | Very-long-chain enoyl-CoA reductase (EC 1.3.1.93) (Synaptic glycoprotein SC2) (Trans-2,3-enoyl-CoA reductase) (TER) | EBI-20626076 | 0.35 |
| Q02978 | Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP) (alpha-oxoglutarate carrier) (Solute carrier family 25 member 11) (SLC25A11) | EBI-20626076 | 0.35 |
| Q29RF7 | Sister chromatid cohesion protein PDS5 homolog A (Cell proliferation-inducing gene 54 protein) (Sister chromatid cohesion protein 112) (SCC-112) | EBI-20626076 | 0.35 |
| B3KY51 | cDNA FLJ46863 fis, clone UTERU3011558 | EBI-20626076 | 0.35 |
| Q92604 | Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 (Acyl-CoA:monoacylglycerol acyltransferase LPGAT1) (EC 2.3.1.22) (Lysophospholipid acyltransferase 7) (LPLAT7) (EC 2.3.1.-) (Stearoyl-CoA:1-lyso-2-acyl-PE acyltransferase) | EBI-20626076 | 0.35 |
| A0A024R3R5 | Delta(14)-sterol reductase LBR (EC 1.3.1.70) (3-beta-hydroxysterol Delta (14)-reductase) (C-14 sterol reductase) (Integral nuclear envelope inner membrane protein) (Lamin-B receptor) (Sterol C14-reductase) | EBI-20626076 | 0.35 |
| Q8WVX9 | Fatty acyl-CoA reductase 1 (EC 1.2.1.84) (Male sterility domain-containing protein 2) | EBI-20626076 | 0.35 |
| O95864 | Acyl-CoA 6-desaturase (EC 1.14.19.3) (Delta(6) fatty acid desaturase) (D6D) (Delta(6) desaturase) (Delta-6 desaturase) (Fatty acid desaturase 2) | EBI-20626076 | 0.35 |
| O94905 | Erlin-2 (Endoplasmic reticulum lipid raft-associated protein 2) (Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2) (SPFH domain-containing protein 2) | EBI-20626076 | 0.35 |
| O75477 | Erlin-1 (Endoplasmic reticulum lipid raft-associated protein 1) (Protein KE04) (Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 1) (SPFH domain-containing protein 1) | EBI-20626076 | 0.35 |
| P11532 | Dystrophin | EBI-20626076 | 0.35 |
| Q96MT8 | Centrosomal protein of 63 kDa (Cep63) | EBI-20626076 | 0.35 |
| P27824 | Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90) | EBI-20626076 | 0.35 |
| P58397 | A disintegrin and metalloproteinase with thrombospondin motifs 12 (ADAM-TS 12) (ADAM-TS12) (ADAMTS-12) (EC 3.4.24.-) | EBI-20626076 | 0.35 |
| Q13442 | 28 kDa heat- and acid-stable phosphoprotein (PDGF-associated protein) (PAP) (PDGFA-associated protein 1) (PAP1) | EBI-20626135 | 0.35 |
| Q9UGN5 | Poly [ADP-ribose] polymerase 2 (PARP-2) (hPARP-2) (EC 2.4.2.30) (ADP-ribosyltransferase diphtheria toxin-like 2) (ARTD2) (DNA ADP-ribosyltransferase PARP2) (EC 2.4.2.-) (NAD(+) ADP-ribosyltransferase 2) (ADPRT-2) (Poly[ADP-ribose] synthase 2) (pADPRT-2) (Protein poly-ADP-ribosyltransferase PARP2) (EC 2.4.2.-) | EBI-20626135 | 0.35 |
| Q9HCK8 | Chromodomain-helicase-DNA-binding protein 8 (CHD-8) (EC 3.6.4.12) (ATP-dependent helicase CHD8) (Helicase with SNF2 domain 1) | EBI-20626135 | 0.35 |
| Q9BSJ8 | Extended synaptotagmin-1 (E-Syt1) (Membrane-bound C2 domain-containing protein) | EBI-20626240 | 0.40 |
| P45880 | Voltage-dependent anion-selective channel protein 2 (VDAC-2) (hVDAC2) (Outer mitochondrial membrane protein porin 2) | EBI-20626197 | 0.35 |
| O14925 | Mitochondrial import inner membrane translocase subunit Tim23 | EBI-20626197 | 0.35 |
| O15260 | Surfeit locus protein 4 | EBI-20626197 | 0.35 |
| P46977 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A (Oligosaccharyl transferase subunit STT3A) (STT3-A) (EC 2.4.99.18) (B5) (Integral membrane protein 1) (Transmembrane protein TMC) | EBI-20626197 | 0.35 |
| Q9UNL2 | Translocon-associated protein subunit gamma (TRAP-gamma) (Signal sequence receptor subunit gamma) (SSR-gamma) | EBI-20626197 | 0.35 |
| O15269 | Serine palmitoyltransferase 1 (EC 2.3.1.50) (Long chain base biosynthesis protein 1) (LCB 1) (Serine-palmitoyl-CoA transferase 1) (SPT 1) (SPT1) | EBI-20626197 | 0.35 |
| P60468 | Protein transport protein Sec61 subunit beta | EBI-20626197 | 0.35 |
| O00767 | Stearoyl-CoA desaturase (hSCD1) (EC 1.14.19.1) (Acyl-CoA desaturase) (Delta(9)-desaturase) (Delta-9 desaturase) (Fatty acid desaturase) | EBI-20626197 | 0.50 |
| Q99623 | Prohibitin-2 (B-cell receptor-associated protein BAP37) (D-prohibitin) (Repressor of estrogen receptor activity) | EBI-20626197 | 0.35 |
| P35232 | Prohibitin 1 | EBI-20626197 | 0.35 |
| O60725 | Protein-S-isoprenylcysteine O-methyltransferase (EC 2.1.1.100) (Isoprenylcysteine carboxylmethyltransferase) (Prenylated protein carboxyl methyltransferase) (PPMT) (Prenylcysteine carboxyl methyltransferase) (pcCMT) | EBI-20626197 | 0.35 |
| Q86UL3 | Glycerol-3-phosphate acyltransferase 4 (EC 2.3.1.15) (1-acylglycerol-3-phosphate O-acyltransferase 6) (1-AGP acyltransferase 6) (1-AGPAT 6) (Acyl-CoA:glycerol-3-phosphate acyltransferase 4) (Lysophosphatidic acid acyltransferase zeta) (LPAAT-zeta) (Testis spermatogenesis apoptosis-related protein 7) (TSARG7) | EBI-20626197 | 0.35 |
| P62877 | E3 ubiquitin-protein ligase RBX1 (EC 2.3.2.27) (EC 2.3.2.32) (E3 ubiquitin-protein transferase RBX1) (Protein ZYP) (RING finger protein 75) (RING-box protein 1) (Rbx1) (Regulator of cullins 1) (ROC1) [Cleaved into: E3 ubiquitin-protein ligase RBX1, N-terminally processed (E3 ubiquitin-protein transferase RBX1, N-terminally processed)] | EBI-20626169 | 0.35 |
| Q13126 | S-methyl-5'-thioadenosine phosphorylase (EC 2.4.2.28) (5'-methylthioadenosine phosphorylase) (MTA phosphorylase) (MTAP) (MTAPase) | EBI-20626169 | 0.35 |
| Q969M3 | Protein YIPF5 (Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5) (Smooth muscle cell-associated protein 5) (SMAP-5) (YIP1 family member 5) (YPT-interacting protein 1 A) | EBI-20626314 | 0.35 |
| Q9H2V7 | Protein spinster homolog 1 (HSpin1) (Spinster-like protein 1) | EBI-20626314 | 0.35 |
| P00403 | Cytochrome c oxidase subunit 2 (EC 7.1.1.9) (Cytochrome c oxidase polypeptide II) | EBI-20626314 | 0.35 |
| Q9Y6C9 | Mitochondrial carrier homolog 2 (Met-induced mitochondrial protein) | EBI-20626314 | 0.35 |
| Q9GZP9 | Derlin-2 (Degradation in endoplasmic reticulum protein 2) (DERtrin-2) (Der1-like protein 2) (F-LAN-1) (F-LANa) | EBI-20626314 | 0.35 |
| Q9NWW5 | Ceroid-lipofuscinosis neuronal protein 6 (Protein CLN6) | EBI-20626314 | 0.54 |
| O95070 | Protein YIF1A (54TMp) (YIP1-interacting factor homolog A) | EBI-20626314 | 0.35 |
| Q8NBI6 | Xyloside xylosyltransferase 1 (EC 2.4.2.62) (UDP-xylose:alpha-xyloside alpha-1,3-xylosyltransferase) | EBI-20626314 | 0.35 |
| Q9Y277 | Voltage-dependent anion-selective channel protein 3 (VDAC-3) (hVDAC3) (Outer mitochondrial membrane protein porin 3) | EBI-20626314 | 0.35 |
| P21796 | Voltage-dependent anion-selective channel protein 1 (VDAC-1) (hVDAC1) (Outer mitochondrial membrane protein porin 1) (Plasmalemmal porin) (Porin 31HL) (Porin 31HM) | EBI-20626314 | 0.35 |
| O95292 | Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C) | EBI-20626314 | 0.35 |
| Q96IX5 | ATP synthase membrane subunit K, mitochondrial (ATP synthase membrane subunit DAPIT, mitochondrial) (Diabetes-associated protein in insulin-sensitive tissues) (HCV F-transactivated protein 2) (Up-regulated during skeletal muscle growth protein 5) | EBI-20626314 | 0.35 |
| Q71U36 | Tubulin alpha-1A chain (EC 3.6.5.-) (Alpha-tubulin 3) (Tubulin B-alpha-1) (Tubulin alpha-3 chain) [Cleaved into: Detyrosinated tubulin alpha-1A chain] | EBI-20626314 | 0.35 |
| B1AH87 | Translocator protein (Peripheral-type benzodiazepine receptor) | EBI-20626314 | 0.35 |
| Q9NS69 | Mitochondrial import receptor subunit TOM22 homolog (hTom22) (1C9-2) (Translocase of outer membrane 22 kDa subunit homolog) | EBI-20626314 | 0.35 |
| Q96JJ7 | Protein disulfide-isomerase TMX3 (EC 5.3.4.1) (Thioredoxin domain-containing protein 10) (Thioredoxin-related transmembrane protein 3) | EBI-20626314 | 0.35 |
| Q5BJD5 | Transmembrane protein 41B (Protein stasimon) | EBI-20626314 | 0.50 |
| Q9HC07 | Transmembrane protein 165 (Transmembrane protein PT27) (Transmembrane protein TPARL) | EBI-20626314 | 0.35 |
| Q9H061 | Transmembrane protein 126A | EBI-20626314 | 0.35 |
| Q9HD45 | Transmembrane 9 superfamily member 3 (EP70-P-iso) (SM-11044-binding protein) | EBI-20626314 | 0.35 |
| Q99805 | Transmembrane 9 superfamily member 2 (p76) | EBI-20626314 | 0.35 |
| Q9NPL8 | Complex I assembly factor TIMMDC1, mitochondrial (Protein M5-14) (Translocase of inner mitochondrial membrane domain-containing protein 1) (TIMM domain containing-protein 1) | EBI-20626314 | 0.35 |
| Q3ZCQ8 | Mitochondrial import inner membrane translocase subunit TIM50 | EBI-20626314 | 0.35 |
| O60830 | Mitochondrial import inner membrane translocase subunit Tim17-B | EBI-20626314 | 0.35 |
| Q7L0J3 | Synaptic vesicle glycoprotein 2A | EBI-20626314 | 0.35 |
| Q9UJZ1 | Stomatin-like protein 2, mitochondrial (SLP-2) (EPB72-like protein 2) (Paraprotein target 7) (Paratarg-7) | EBI-20626314 | 0.35 |
| Q01650 | Large neutral amino acids transporter small subunit 1 (4F2 light chain) (4F2 LC) (4F2LC) (CD98 light chain) (Integral membrane protein E16) (E16) (L-type amino acid transporter 1) (hLAT1) (Solute carrier family 7 member 5) (y+ system cationic amino acid transporter) | EBI-20626314 | 0.35 |
| P08195 | 4F2 cell-surface antigen heavy chain (4F2hc) (4F2 heavy chain antigen) (Lymphocyte activation antigen 4F2 large subunit) (Solute carrier family 3 member 2) (CD antigen CD98) | EBI-20626314 | 0.35 |
| C4N9M8 | Zinc transporter ZIP9 (ZIP-9) (Solute carrier family 39 member 9) (Zrt- and Irt-like protein 9) | EBI-20626314 | 0.35 |
| Q9H2H9 | Sodium-coupled neutral amino acid symporter 1 (Amino acid transporter A1) (N-system amino acid transporter 2) (Solute carrier family 38 member 1) (System A amino acid transporter 1) (System N amino acid transporter 1) | EBI-20626314 | 0.35 |
| P11166 | Solute carrier family 2, facilitated glucose transporter member 1 (Glucose transporter type 1, erythrocyte/brain) (GLUT-1) (HepG2 glucose transporter) | EBI-20626314 | 0.35 |
| P12236 | ADP/ATP translocase 3 (ADP,ATP carrier protein 3) (ADP,ATP carrier protein, isoform T2) (ANT 2) (Adenine nucleotide translocator 3) (ANT 3) (Solute carrier family 25 member 6) [Cleaved into: ADP/ATP translocase 3, N-terminally processed] | EBI-20626314 | 0.35 |
| Q00325 | Phosphate carrier protein, mitochondrial (Phosphate transport protein) (PTP) (Solute carrier family 25 member 3) | EBI-20626314 | 0.35 |
| Q9H936 | Mitochondrial glutamate carrier 1 (GC-1) (Glutamate/H(+) symporter 1) (Solute carrier family 25 member 22) | EBI-20626314 | 0.35 |
| Q9UJS0 | Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial (Calcium-binding mitochondrial carrier protein Aralar2) (ARALAR-related gene 2) (ARALAR2) (Citrin) (Mitochondrial aspartate glutamate carrier 2) (Solute carrier family 25 member 13) | EBI-20626314 | 0.35 |
| O75746 | Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial (Araceli hiperlarga) (Aralar) (Aralar1) (Mitochondrial aspartate glutamate carrier 1) (Solute carrier family 25 member 12) | EBI-20626314 | 0.35 |
| Q15758 | Neutral amino acid transporter B(0) (ATB(0)) (Baboon M7 virus receptor) (RD114/simian type D retrovirus receptor) (Sodium-dependent neutral amino acid transporter type 2) (Solute carrier family 1 member 5) | EBI-20626314 | 0.35 |
| P53985 | Monocarboxylate transporter 1 (MCT 1) (Solute carrier family 16 member 1) | EBI-20626314 | 0.35 |
| Q96EP9 | Sodium/bile acid cotransporter 4 (Na(+)/bile acid cotransporter 4) (Solute carrier family 10 member 4) | EBI-20626314 | 0.35 |
| Q9BWM7 | Sideroflexin-3 | EBI-20626314 | 0.35 |
| P61619 | Protein transport protein Sec61 subunit alpha isoform 1 (Sec61 alpha-1) | EBI-20626314 | 0.35 |
| Q86SK9 | Stearoyl-CoA desaturase 5 (EC 1.14.19.1) (Acyl-CoA-desaturase 4) (HSCD5) (Stearoyl-CoA 9-desaturase) (Stearoyl-CoA desaturase 2) | EBI-20626314 | 0.35 |
| Q8TAC9 | Secretory carrier-associated membrane protein 5 (Secretory carrier membrane protein 5) (hSCAMP5) | EBI-20626314 | 0.35 |
| O14828 | Secretory carrier-associated membrane protein 3 (Secretory carrier membrane protein 3) | EBI-20626314 | 0.35 |
| O75845 | Lathosterol oxidase (EC 1.14.19.20) (C-5 sterol desaturase) (Delta(7)-sterol 5-desaturase) (Delta(7)-sterol C5(6)-desaturase) (Lathosterol 5-desaturase) (Sterol-C5-desaturase) | EBI-20626314 | 0.35 |
| Q9NTJ5 | Phosphatidylinositol-3-phosphatase SAC1 (EC 3.1.3.64) (Phosphatidylinositol-4-phosphate phosphatase) (Suppressor of actin mutations 1-like protein) | EBI-20626314 | 0.35 |
| Q96ER3 | Protein SAAL1 (Synoviocyte proliferation-associated in collagen-induced arthritis protein 1) (SPACIA1) | EBI-20626314 | 0.35 |
| P04844 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit) (RIBIIR) (Ribophorin II) (RPN-II) (Ribophorin-2) | EBI-20626314 | 0.35 |
| O43251 | RNA binding protein fox-1 homolog 2 (Fox-1 homolog B) (Hexaribonucleotide-binding protein 2) (RNA-binding motif protein 9) (RNA-binding protein 9) (Repressor of tamoxifen transcriptional activity) | EBI-20626314 | 0.50 |
| Q14964 | Ras-related protein Rab-39A (Rab-39) | EBI-20626314 | 0.35 |
| Q9NP72 | Ras-related protein Rab-18 | EBI-20626314 | 0.35 |
| O60831 | PRA1 family protein 2 | EBI-20626314 | 0.35 |
| O00264 | Membrane-associated progesterone receptor component 1 (mPR) (Dap1) (IZA) | EBI-20626314 | 0.35 |
| Q15070 | Mitochondrial inner membrane protein OXA1L (Hsa) (OXA1Hs) (Oxidase assembly 1-like protein) (OXA1-like protein) | EBI-20626314 | 0.35 |
| P01111 | GTPase NRas (EC 3.6.5.2) (Transforming protein N-Ras) | EBI-20626314 | 0.35 |
| O75352 | Mannose-P-dolichol utilization defect 1 protein (Suppressor of Lec15 and Lec35 glycosylation mutation homolog) (SL15) | EBI-20626314 | 0.35 |
| Q13015 | Protein AF1q | EBI-20626314 | 0.35 |
| O95490 | Adhesion G protein-coupled receptor L2 (Calcium-independent alpha-latrotoxin receptor 2) (CIRL-2) (Latrophilin homolog 1) (Latrophilin-2) (Lectomedin-1) | EBI-20626314 | 0.35 |
| Q8NF37 | Lysophosphatidylcholine acyltransferase 1 (LPC acyltransferase 1) (LPCAT-1) (LysoPC acyltransferase 1) (EC 2.3.1.23) (1-acylglycerol-3-phosphate O-acyltransferase) (EC 2.3.1.51) (1-acylglycerophosphocholine O-acyltransferase) (1-alkenylglycerophosphocholine O-acyltransferase) (EC 2.3.1.25) (1-alkylglycerophosphocholine O-acetyltransferase) (EC 2.3.1.67) (Acetyl-CoA:lyso-platelet-activating factor acetyltransferase) (Acetyl-CoA:lyso-PAF acetyltransferase) (Lyso-PAF acetyltransferase) (LysoPAFAT) (Acyltransferase-like 2) (Phosphonoformate immuno-associated protein 3) | EBI-20626314 | 0.35 |
| Q8N6L1 | Keratinocyte-associated protein 2 (KCP-2) (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2) (Oligosaccharyl transferase subunit KCP2) | EBI-20626314 | 0.35 |
| Q8TEX9 | Importin-4 (Imp4) (Importin-4b) (Imp4b) (Ran-binding protein 4) (RanBP4) | EBI-20626314 | 0.35 |
| Q16891 | MICOS complex subunit MIC60 (Cell proliferation-inducing gene 4/52 protein) (Mitochondrial inner membrane protein) (Mitofilin) (p87/89) | EBI-20626314 | 0.35 |
| Q53GQ0 | Very-long-chain 3-oxoacyl-CoA reductase (EC 1.1.1.330) (17-beta-hydroxysteroid dehydrogenase 12) (17-beta-HSD 12) (3-ketoacyl-CoA reductase) (KAR) (Estradiol 17-beta-dehydrogenase 12) (EC 1.1.1.62) (Short chain dehydrogenase/reductase family 12C member 1) | EBI-20626314 | 0.35 |
| Q8TCT9 | Minor histocompatibility antigen H13 (EC 3.4.23.-) (Intramembrane protease 1) (IMP-1) (IMPAS-1) (hIMP1) (Presenilin-like protein 3) (Signal peptide peptidase) | EBI-20626314 | 0.35 |
| P04439 | HLA class I histocompatibility antigen, A alpha chain (Human leukocyte antigen A) (HLA-A) | EBI-20626314 | 0.35 |
| O75367 | Core histone macro-H2A.1 (Histone macroH2A1) (mH2A1) (Histone H2A.y) (H2A/y) (Medulloblastoma antigen MU-MB-50.205) | EBI-20626314 | 0.35 |
| P08754 | Guanine nucleotide-binding protein G(i) subunit alpha-3 (G(i) alpha-3) | EBI-20626314 | 0.35 |
| Q9H0Q3 | FXYD domain-containing ion transport regulator 6 (Phosphohippolin) | EBI-20626314 | 0.35 |
| Q86VR2 | Reticulophagy regulator 3 | EBI-20626314 | 0.35 |
| Q9BW60 | Elongation of very long chain fatty acids protein 1 (EC 2.3.1.199) (3-keto acyl-CoA synthase ELOVL1) (ELOVL fatty acid elongase 1) (ELOVL FA elongase 1) (Very long chain 3-ketoacyl-CoA synthase 1) (Very long chain 3-oxoacyl-CoA synthase 1) | EBI-20626314 | 0.35 |
| O75165 | DnaJ homolog subfamily C member 13 (Required for receptor-mediated endocytosis 8) (RME-8) | EBI-20626314 | 0.35 |
| Q9UBM7 | 7-dehydrocholesterol reductase (7-DHC reductase) (EC 1.3.1.21) (Delta7-sterol reductase) (Sterol Delta(7)-reductase) (Sterol reductase SR-2) | EBI-20626314 | 0.35 |
| Q15392 | Delta(24)-sterol reductase (EC 1.3.1.72) (24-dehydrocholesterol reductase) (3-beta-hydroxysterol Delta-24-reductase) (Diminuto/dwarf1 homolog) (Seladin-1) | EBI-20626314 | 0.35 |
| P39656 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit (DDOST 48 kDa subunit) (Oligosaccharyl transferase 48 kDa subunit) | EBI-20626314 | 0.35 |
| Q7KZN9 | Cytochrome c oxidase assembly protein COX15 homolog | EBI-20626314 | 0.35 |
| Q9UBF2 | Coatomer subunit gamma-2 (Gamma-2-coat protein) (Gamma-2-COP) | EBI-20626314 | 0.35 |
| Q9NX63 | MICOS complex subunit MIC19 (Coiled-coil-helix-coiled-coil-helix domain-containing protein 3) | EBI-20626314 | 0.35 |
| Q8N111 | Cell cycle exit and neuronal differentiation protein 1 (BM88 antigen) | EBI-20626314 | 0.50 |
| O95674 | Phosphatidate cytidylyltransferase 2 (EC 2.7.7.41) (CDP-DAG synthase 2) (CDP-DG synthase 2) (CDP-diacylglycerol synthase 2) (CDS 2) (CDP-diglyceride pyrophosphorylase 2) (CDP-diglyceride synthase 2) (CTP:phosphatidate cytidylyltransferase 2) | EBI-20626314 | 0.35 |
| O14735 | CDP-diacylglycerol--inositol 3-phosphatidyltransferase (EC 2.7.8.11) (Phosphatidylinositol synthase) (PI synthase) (PtdIns synthase) | EBI-20626314 | 0.35 |
| Q96A33 | PAT complex subunit CCDC47 (Calumin) (Coiled-coil domain-containing protein 47) | EBI-20626314 | 0.35 |
| P35613 | Basigin (5F7) (Collagenase stimulatory factor) (Extracellular matrix metalloproteinase inducer) (EMMPRIN) (Hepatoma-associated antigen) (HAb18G) (Leukocyte activation antigen M6) (OK blood group antigen) (Tumor cell-derived collagenase stimulatory factor) (TCSF) (CD antigen CD147) | EBI-20626314 | 0.35 |
| Q9Y679 | Lipid droplet-regulating VLDL assembly factor AUP1 (Ancient ubiquitous protein 1) | EBI-20626314 | 0.35 |
| Q01814 | Plasma membrane calcium-transporting ATPase 2 (PMCA2) (EC 7.2.2.10) (Plasma membrane calcium ATPase isoform 2) (Plasma membrane calcium pump isoform 2) | EBI-20626314 | 0.35 |
| O14983 | Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (SERCA1) (SR Ca(2+)-ATPase 1) (EC 7.2.2.10) (Calcium pump 1) (Calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle isoform) (Endoplasmic reticulum class 1/2 Ca(2+) ATPase) | EBI-20626314 | 0.35 |
| P05026 | Sodium/potassium-transporting ATPase subunit beta-1 (Sodium/potassium-dependent ATPase subunit beta-1) | EBI-20626314 | 0.35 |
| P13637 | Sodium/potassium-transporting ATPase subunit alpha-3 (Na(+)/K(+) ATPase alpha-3 subunit) (EC 7.2.2.13) (Na(+)/K(+) ATPase alpha(III) subunit) (Sodium pump subunit alpha-3) | EBI-20626314 | 0.35 |
| P05023 | Sodium/potassium-transporting ATPase subunit alpha-1 (Na(+)/K(+) ATPase alpha-1 subunit) (EC 7.2.2.13) (Sodium pump subunit alpha-1) | EBI-20626314 | 0.35 |
| Q9BVK2 | Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase (EC 2.4.1.265) (Asparagine-linked glycosylation protein 8 homolog) (Dol-P-Glc:Glc(1)Man(9)GlcNAc(2)-PP-dolichyl alpha-1,3-glucosyltransferase) (Dolichyl-P-Glc:Glc1Man9GlcNAc2-PP-dolichyl glucosyltransferase) | EBI-20626314 | 0.35 |
| Q9NP58 | ATP-binding cassette sub-family B member 6 (ABC-type heme transporter ABCB6) (EC 7.6.2.5) (Mitochondrial ABC transporter 3) (Mt-ABC transporter 3) (P-glycoprotein-related protein) (Ubiquitously-expressed mammalian ABC half transporter) | EBI-20626314 | 0.35 |
| Q9Y312 | Protein AAR2 homolog (AAR2 splicing factor homolog) | EBI-20626314 | 0.35 |
| Q99653 | Calcineurin B homologous protein 1 (Calcineurin B-like protein) (Calcium-binding protein CHP) (Calcium-binding protein p22) (EF-hand calcium-binding domain-containing protein p22) | EBI-20639074 | 0.50 |
Database | Links |
| UNIPROT | A0A142I5B9 H9A910 |
| PDB | 6UTA 7BPK 7BQ5 |
| Pfam | PF01003 PF07652 PF02832 PF00869 PF01004 PF00948 PF01005 PF01002 PF01350 PF01349 PF00972 PF01570 PF01728 PF00949 |
| PROSITE | PS51527 PS51528 PS51192 PS51194 PS50507 PS51591 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory