RNA-directed RNA polymerase NS5 - Zika virus ZIKV/Human/Cambodia/FSS13025/2010

RNA-directed RNA polymerase NS5 (Zika virus ZIKV/Human/Cambodia/FSS13025/2010)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	RNA-directed RNA polymerase NS5
Accession Code	A0A142I5B9
Gene	POLG
Organism	Zika virus ZIKV/Human/Cambodia/FSS13025/2010 (Taxonomy: 2316109)
Part of Reference Proteome?	No
Sequence (Length: 3423)
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEI IKKFKKDLAAMLRIINARKEKKRRGTDTSVGIVGLLLTTAMAVEVTRRGNAYYMYLDRSDAGEAISFPTTMGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVTLPSHSTRKLQTRSQTWLESREY TKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKVIYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGC VTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGK GSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDC EPRTGLDFSDLYYLTMNNKHWLVHKEWFHDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALA GALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQ TLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWD FGSVGGALNSLGKGIHQIFGAAFKSLFGGMSWFSQILIGTLLVWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGCSV DFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSRMENIMWRSVEGELNAILEENGVQL TVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGKSYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTS VWLKVREDYSLECDPAVIGTAAKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGIEESDLIIPKS LAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTRGPSLRSTTASGRVIEEWCCRECTMPPLSFRAK DGCWYGMEIRPRKEPESNLVRSMVTAGSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDL AKLAILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQTAISALEGDLMVPINGFAL AWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGLATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINV VGLLLLTRSGKRSWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKDAEVT GNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMAICGMNPIAIPFAAGAWYVYVKTGKRSGALWDVPAPKEVKKGET TDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLL AVPPGERARNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGRREEETPVEC FEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAPTRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIV DLMCHATFTSRLLQPIRVPNYNLYIMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEV EVPERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKTKHQEWDFVVTTDISEMGANF KADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQRRGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIY LQDGLIASLYRPEADKVAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIMEDSVPA EVWTRYGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPY KAAAAQLPETLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIP EPEKQRSPQDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPASAWAIYAALTTFIT PAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPLLMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAA ARAAQKRTAAGIMKNPVVDGIVVTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQMSALEFYSYKKSGITEVCREEA RRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGKVIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPMLVQSYG WNIVRLKSGVDVFHMAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMMETLERLQR RYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRPVKYEEDVNLGSGTRAVVSCAEAPNMKIIGN RIERIRSEHAETWFFDENHPYRTWAYHGSYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKV DTRVPDPQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAVEAVNDPRFWALVDKER EHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGARFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVL EEMSRIPGGRMYADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQDQ RGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHAL RFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHHFNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSY AQMWQLLYFHRRDLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKTPVTKWTDIPY LGKREDLWCGSLIGHRPRTTWAENIKNTVNMMRRIIGDEEKYVDYLSTQVRYLGEEGSTPGVL

Structure Viewer (PDB: 6UTA)

Subcellular Location

Description
[Capsid protein C]: Virion {By SimilarityUniProtKB:P17763}. Host nucleus {By SimilarityUniProtKB:P17763}. Host cytoplasm {By SimilarityUniProtKB:P06935}. Host cytoplasm, host perinuclear region {By SimilarityUniProtKB:P06935}. [Peptide pr]: Secreted {By SimilarityUniProtKB:P17763}. [Small envelope protein M]: Virion membrane {By SimilarityUniProtKB:P17763}; Multi-pass membrane protein {Sequence Analysis}. Host endoplasmic reticulum membrane {By SimilarityUniProtKB:P17763}; Multi-pass membrane protein {Sequence Analysis}. [Envelope protein E]: Virion membrane {By SimilarityUniProtKB:P17763}; Multi-pass membrane protein {Sequence Analysis}. Host endoplasmic reticulum membrane {By SimilarityUniProtKB:P17763}; Multi-pass membrane protein {Sequence Analysis}. Host cell surface {ECO:0000269\|PubMed:33432092}. [Non-structural protein 1]: Secreted {By SimilarityUniProtKB:P17763}. Host endoplasmic reticulum membrane {ECO:0000250\|UniProtKB:Q32ZE1}; Peripheral membrane protein {ECO:0000250\|UniProtKB:Q32ZE1}; Lumenal side {By SimilarityUniProtKB:P17763}. Note=Located in RE-derived vesicles hosting the replication complex. {ECO:0000250\|UniProtKB:Q9Q6P4}. [Non-structural protein 2A]: Host endoplasmic reticulum membrane {By SimilarityUniProtKB:P17763}; Multi-pass membrane protein {By SimilarityUniProtKB:P17763}. [Serine protease NS3]: Host endoplasmic reticulum membrane {Sequence Analysis\|PROSITE-ProRule:PRU00860}; Peripheral membrane protein {Sequence Analysis\|PROSITE-ProRule:PRU00860}; Cytoplasmic side {Sequence Analysis\|PROSITE-ProRule:PRU00860}. Note=Remains non-covalently associated to serine protease subunit NS2B. {Sequence Analysis\|PROSITE- ProRule:PRU00860}. [Non-structural protein 4A]: Host endoplasmic reticulum membrane {By SimilarityUniProtKB:P17763}; Multi-pass membrane protein {By SimilarityUniProtKB:P17763}. Note=Located in RE-associated vesicles hosting the replication complex. {By SimilarityUniProtKB:P17763}. [Non-structural protein 4B]: Host endoplasmic reticulum membrane {By SimilarityUniProtKB:P17763}; Multi-pass membrane protein {By SimilarityUniProtKB:P17763}. Note=Located in RE-derived vesicles hosting the replication complex. {ECO:0000250\|UniProtKB:Q9Q6P4}. [RNA-directed RNA polymerase NS5]: Host endoplasmic reticulum membrane {ECO:0000250\|UniProtKB:Q32ZE1}; Peripheral membrane protein {ECO:0000250\|UniProtKB:Q32ZE1}; Cytoplasmic side {ECO:0000250\|UniProtKB:Q32ZE1}. Host nucleus {By SimilarityUniProtKB:P17763}. Note=Located in RE-associated vesicles hosting the replication complex. NS5 protein is mainly localized in the nucleus rather than in ER vesicles. {By SimilarityUniProtKB:P17763}.
Position in the Nuclear Envelope
Location	Location ID	Description
Host Perinuclear Region	SL-0382	The host perinuclear region is the host cytoplasmic region just around the host nucleus. Note: This location is defined for viral proteins that appear in the perinuclear region of infected host cells
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Extracellular Region (GO:0005576) Host Cell Endoplasmic Reticulum Membrane (GO:0044167) Host Cell Nucleus (GO:0042025) Host Cell Perinuclear Region Of Cytoplasm (GO:0044220) Host Cell Surface (GO:0044228) Viral Capsid (GO:0019028) Virion Membrane (GO:0055036)

Biology & Function

Description
[Capsid protein C]: Plays a role in virus budding by binding to the cell membrane and gathering the viral RNA into a nucleocapsid that forms the core of the mature virus particle. During virus entry, may induce genome penetration into the host cytoplasm after hemifusion induced by the surface proteins. Can migrate to the cell nucleus where it modulates host functions. {By SimilarityUniProtKB:P17763}. [Capsid protein C]: Inhibits RNA silencing by interfering with host Dicer. {By SimilarityUniProtKB:P03314}. [Peptide pr]: Prevents premature fusion activity of envelope proteins in trans-Golgi by binding to envelope protein E at pH 6.0. After virion release in extracellular space, gets dissociated from E dimers. {By SimilarityUniProtKB:P17763}. [Protein prM]: Plays a role in host immune defense modulation and protection of envelope protein E during virion synthesis. PrM-E cleavage is inefficient, many virions are only partially matured and immature prM-E proteins could play a role in immune evasion. Contributes to fetal microcephaly in humans. Acts as a chaperone for envelope protein E during intracellular virion assembly by masking and inactivating envelope protein E fusion peptide. prM is the only viral peptide matured by host furin in the trans-Golgi network probably to avoid catastrophic activation of the viral fusion activity in acidic Golgi compartment prior to virion release. {By SimilarityUniProtKB:P17763}. [Small envelope protein M]: May play a role in virus budding. Exerts cytotoxic effects by activating a mitochondrial apoptotic pathway through M ectodomain. May display a viroporin activity. {By SimilarityUniProtKB:P17763}. [Envelope protein E]: Binds to host cell surface receptors and mediates fusion between viral and cellular membranes. Efficient virus attachment to cell is, at least in part, mediated by host HAVCR1 in a cell-type specific manner (PubMed:32641828). In addition, host NCAM1 can also be used as entry receptor (PubMed:32753727). Interaction with host HSPA5 plays an important role in the early stages of infection as well (PubMed:33432092). Envelope protein is synthesized in the endoplasmic reticulum and forms a heterodimer with protein prM. The heterodimer plays a role in virion budding in the ER, and the newly formed immature particle is covered with 60 spikes composed of heterodimers between precursor prM and envelope protein E. The virion is transported to the Golgi apparatus where the low pH causes the dissociation of PrM-E heterodimers and formation of E homodimers. PrM-E cleavage is inefficient, many virions are only partially matured and immature prM-E proteins could play a role in immune evasion (By similarity). {By SimilarityUniProtKB:P17763, Experimental EvidencePubMed:32641828, Experimental EvidencePubMed:32753727, Experimental EvidencePubMed:33432092}. [Non-structural protein 1]: Plays a role in the inhibition of host RLR-induced interferon-beta activation by targeting TANK-binding kinase 1/TBK1. In addition, recruits the host deubiquitinase USP8 to cleave 'Lys-11'-linked polyubiquitin chains from caspase-1/CASP1 thus inhibiting its proteasomal degradation. In turn, stabilized CASP1 promotes cleavage of cGAS, which inhibits its ability to recognize mitochondrial DNA release and initiate type I interferon signaling. {ECO:0000250\|UniProtKB:Q32ZE1}. [Non-structural protein 2A]: Component of the viral RNA replication complex that recruits genomic RNA, the structural protein prM/E complex, and the NS2B/NS3 protease complex to the virion assembly site and orchestrates virus morphogenesis (PubMed:31662457). Antagonizes also the host alpha/beta interferon antiviral response (By similarity). May disrupt adherens junction formation and thereby impair proliferation of radial cells in the host cortex (By similarity). {ECO:0000250\|UniProtKB:Q32ZE1, ECO:0000269\|PubMed:31662457}. [Serine protease subunit NS2B]: Required cofactor for the serine protease function of NS3. {ECO:0000250\|UniProtKB:Q32ZE1}. [Serine protease NS3]: Displays three enzymatic activities: serine protease, NTPase and RNA helicase. NS3 serine protease, in association with NS2B, performs its autocleavage and cleaves the polyprotein at dibasic sites in the cytoplasm: C-prM, NS2A-NS2B, NS2B- NS3, NS3-NS4A, NS4A-2K and NS4B-NS5. NS3 RNA helicase binds RNA and unwinds dsRNA in the 3' to 5' direction (By similarity). Leads to translation arrest when expressed ex vivo (By similarity). {ECO:0000250\|UniProtKB:A0A024B7W1, ECO:0000250\|UniProtKB:Q32ZE1}. [Non-structural protein 4A]: Regulates the ATPase activity of the NS3 helicase activity (By similarity). NS4A allows NS3 helicase to conserve energy during unwinding (By similarity). Cooperatively with NS4B suppresses the Akt-mTOR pathway and leads to cellular dysregulation (By similarity). By inhibiting host ANKLE2 functions, may cause defects in brain development, such as microcephaly (By similarity). Antagonizes also the host MDA5-mediated induction of alpha/beta interferon antiviral response (By similarity). Leads to translation arrest when expressed ex vivo (By similarity). {ECO:0000250\|UniProtKB:A0A024B7W1, ECO:0000250\|UniProtKB:Q32ZE1, ECO:0000250\|UniProtKB:Q9Q6P4}. [Peptide 2k]: Functions as a signal peptide for NS4B and is required for the interferon antagonism activity of the latter. {By SimilarityUniProtKB:P17763}. [Non-structural protein 4B]: Induces the formation of ER- derived membrane vesicles where the viral replication takes place (By similarity). Also plays a role in the inhibition of host RLR-induced interferon-beta production at TANK-binding kinase 1/TBK1 level (By similarity). Cooperatively with NS4A suppresses the Akt-mTOR pathway and leads to cellular dysregulation (By similarity). {ECO:0000250\|UniProtKB:Q32ZE1, ECO:0000250\|UniProtKB:Q9Q6P4}. [RNA-directed RNA polymerase NS5]: Replicates the viral (+) and (-) RNA genome, and performs the capping of genomes in the cytoplasm (By similarity). Methylates viral RNA cap at guanine N-7 and ribose 2'-O positions. Once sufficient NS5 is expressed, binds to the cap-proximal structure and inhibits further translation of the viral genome (By similarity). Besides its role in RNA genome replication, also prevents the establishment of a cellular antiviral state by blocking the interferon-alpha/beta (IFN-alpha/beta) signaling pathway. Mechanistically, interferes with host kinases TBK1 and IKKE upstream of interferon regulatory factor 3/IRF3 to inhibit the RIG-I pathway (By similarity). Antagonizes also type I interferon signaling by targeting STAT2 for degradation by the proteasome thereby preventing activation of JAK-STAT signaling pathway (By similarity). Within the host nucleus, disrupts host SUMO1 and STAT2 co-localization with PML, resulting in PML degradation (By similarity). May also reduce immune responses by preventing the recruitment of the host PAF1 complex to interferon- responsive genes (By similarity). {ECO:0000250\|UniProtKB:A0A024B7W1, ECO:0000250\|UniProtKB:Q32ZE1}.
Assigned Ontology terms

Biological Process	Fusion Of Virus Membrane With Host Endosome Membrane (GO:0039654) Induction By Virus Of Host Autophagy (GO:0039520) Proteolysis (GO:0006508) Suppression By Virus Of Host JAK-STAT Cascade Via Inhibition Of STAT2 Activity (GO:0039564) Suppression By Virus Of Host Type I Interferon-Mediated Signaling Pathway (GO:0039502) Viral Entry Into Host Cell (GO:0046718) Viral RNA Genome Replication (GO:0039694) Virion Attachment To Host Cell (GO:0019062)
Molecular Function	ATP Binding (GO:0005524) ATP Hydrolysis Activity (GO:0016887) Double-Stranded RNA Binding (GO:0003725) GTP Binding (GO:0005525) Metal Ion Binding (GO:0046872) MRNA (Guanine-N7-)-Methyltransferase Activity (GO:0004482) MRNA (Nucleoside-2'-O-)-Methyltransferase Activity (GO:0004483) Protein Dimerization Activity (GO:0046983) RNA Helicase Activity (GO:0003724) RNA-Dependent RNA Polymerase Activity (GO:0003968) Serine-Type Endopeptidase Activity (GO:0004252) Structural Molecule Activity (GO:0005198)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (28 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q15633	RISC-loading complex subunit TARBP2	EBI-20625330	0.35
Q5JTH9	RRP12-like protein	EBI-20625330	0.35
P63244	Receptor of activated protein C kinase 1, N-terminally processed	EBI-20625330	0.35
P57088	Transmembrane protein 33	EBI-20626314	0.35
Q9NRG9	Aladin	EBI-20626314	0.35
O95831	Apoptosis-inducing factor 1, mitochondrial	EBI-20625330	0.35
Q9Y6K0	Choline/ethanolaminephosphotransferase 1	EBI-20626314	0.35
Q07065	Cytoskeleton-associated protein 4	EBI-20626314	0.35
Q9BV73	Centrosome-associated protein CEP250	EBI-20626135	0.35
Q9UPY3	Endoribonuclease Dicer	EBI-20625330	0.35
P31689	DnaJ homolog subfamily A member 1	EBI-20625330	0.35
Q15125	3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase	EBI-20626314	0.35
O14681	Etoposide-induced protein 2.4 homolog	EBI-20626169	0.35
O00165	HCLS1-associated protein X-1	EBI-20626314	0.35
Q14974	Importin subunit beta-1	EBI-20625330	0.35
Q86UE4	Protein LYRIC	EBI-20625330	0.35
Q9BTX1	Nucleoporin NDC1	EBI-20626314	0.35
Q9NXE4	Sphingomyelin phosphodiesterase 4	EBI-20626314	0.35
P57740	Nuclear pore complex protein Nup107	EBI-20625330	0.35
Q8WUM0	Nuclear pore complex protein Nup133	EBI-20625330	0.35
Q12769	Nuclear pore complex protein Nup160	EBI-20625330	0.35
Q92621	Nuclear pore complex protein Nup205	EBI-20625330	0.35
Q8NFH3	Nucleoporin Nup43	EBI-20625330	0.35
Q9BW27	Nuclear pore complex protein Nup85	EBI-20625330	0.35
Q8N1F7	Nuclear pore complex protein Nup93	EBI-20626314	0.35
P52948	Nuclear pore complex protein Nup96	EBI-20625330	0.35
Q8NC51	Plasminogen activator inhibitor 1 RNA-binding protein	EBI-20625330	0.35
O15173	Membrane-associated progesterone receptor component 2	EBI-20626314	0.35
Interactions with other proteins (357 interactors)

Partner (UniProt)		IntAct	Confidence score
P35251	Replication factor C subunit 1 (Activator 1 140 kDa subunit) (A1 140 kDa subunit) (Activator 1 large subunit) (Activator 1 subunit 1) (DNA-binding protein PO-GA) (Replication factor C 140 kDa subunit) (RF-C 140 kDa subunit) (RFC140) (Replication factor C large subunit)	EBI-20625330	0.35
Q01105	Protein SET (HLA-DR-associated protein II) (Inhibitor of granzyme A-activated DNase) (IGAAD) (PHAPII) (Phosphatase 2A inhibitor I2PP2A) (I-2PP2A) (Template-activating factor I) (TAF-I)	EBI-20625330	0.35
Q9BSC4	Nucleolar protein 10	EBI-20625330	0.35
Q7Z7F7	39S ribosomal protein L55, mitochondrial (L55mt) (MRP-L55) (Mitochondrial large ribosomal subunit protein bL31m) (Mitochondrial large ribosomal subunit protein mL55)	EBI-20625330	0.35
Q6P161	39S ribosomal protein L54, mitochondrial (L54mt) (MRP-L54) (Mitochondrial large ribosomal subunit protein mL54)	EBI-20625330	0.35
Q9NRX2	39S ribosomal protein L17, mitochondrial (L17mt) (MRP-L17) (LYST-interacting protein 2) (Mitochondrial large ribosomal subunit protein bL17m)	EBI-20625330	0.35
Q9H5H4	Zinc finger protein 768	EBI-20625330	0.35
Q9UEG4	Zinc finger protein 629 (Zinc finger protein 65)	EBI-20625330	0.35
Q969S3	Cytoplasmic 60S subunit biogenesis factor ZNF622 (Zinc finger protein 622) (Zinc finger-like protein 9)	EBI-20625330	0.35
Q96ME7	Zinc finger protein 512	EBI-20625330	0.35
Q96KR1	Zinc finger RNA-binding protein (hZFR) (M-phase phosphoprotein homolog)	EBI-20625330	0.35
Q6NZY4	Zinc finger CCHC domain-containing protein 8 (TRAMP-like complex RNA-binding factor ZCCHC8)	EBI-20625330	0.35
Q7Z2W4	Zinc finger CCCH-type antiviral protein 1 (ADP-ribosyltransferase diphtheria toxin-like 13) (ARTD13) (Inactive Poly [ADP-ribose] polymerase 13) (PARP13) (Zinc finger CCCH domain-containing protein 2) (Zinc finger antiviral protein) (ZAP)	EBI-20625330	0.35
O43592	Exportin-T (Exportin(tRNA)) (tRNA exportin)	EBI-20625330	0.35
Q9H269	Vacuolar protein sorting-associated protein 16 homolog (hVPS16)	EBI-20625330	0.35
O15240	Neurosecretory protein VGF [Cleaved into: Neuroendocrine regulatory peptide-1 (NERP-1); Neuroendocrine regulatory peptide-2 (NERP-2); VGF-derived peptide TLQP-21; VGF-derived peptide TLQP-62; Antimicrobial peptide VGF[554-577]]	EBI-20625330	0.35
Q93008	Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC 3.4.19.12) (Deubiquitinating enzyme FAF-X) (Fat facets in mammals) (hFAM) (Fat facets protein-related, X-linked) (Ubiquitin thioesterase FAF-X) (Ubiquitin-specific protease 9, X chromosome) (Ubiquitin-specific-processing protease FAF-X)	EBI-20625330	0.35
Q13509	Tubulin beta-3 chain (Tubulin beta-4 chain) (Tubulin beta-III)	EBI-20625330	0.35
Q12899	Tripartite motif-containing protein 26 (EC 2.3.2.27) (Acid finger protein) (AFP) (RING finger protein 95) (Zinc finger protein 173)	EBI-20625330	0.35
P11387	DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I)	EBI-20625330	0.35
Q9UM00	Calcium load-activated calcium channel (CLAC channel) (Transmembrane and coiled-coil domain-containing protein 1) (Transmembrane and coiled-coil domains protein 4) (Xenogeneic cross-immune protein PCIA3)	EBI-20625330	0.35
O75683	Surfeit locus protein 6	EBI-20625330	0.35
Q13243	Serine/arginine-rich splicing factor 5 (Delayed-early protein HRS) (Pre-mRNA-splicing factor SRP40) (Splicing factor, arginine/serine-rich 5)	EBI-20625330	0.35
Q9BXP5	Serrate RNA effector molecule homolog (Arsenite-resistance protein 2)	EBI-20625330	0.35
Q96SB4	SRSF protein kinase 1 (EC 2.7.11.1) (SFRS protein kinase 1) (Serine/arginine-rich protein-specific kinase 1) (SR-protein-specific kinase 1)	EBI-20625330	0.35
Q13501	Sequestosome-1 (EBI3-associated protein of 60 kDa) (EBIAP) (p60) (Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa) (Ubiquitin-binding protein p62)	EBI-20625330	0.35
Q16637	Survival motor neuron protein (Component of gems 1) (Gemin-1)	EBI-20625330	0.50
Q9NTJ3	Structural maintenance of chromosomes protein 4 (SMC protein 4) (SMC-4) (Chromosome-associated polypeptide C) (hCAP-C) (XCAP-C homolog)	EBI-20625330	0.35
O95347	Structural maintenance of chromosomes protein 2 (SMC protein 2) (SMC-2) (Chromosome-associated protein E) (hCAP-E) (XCAP-E homolog)	EBI-20625330	0.35
P53007	Tricarboxylate transport protein, mitochondrial (Citrate transport protein) (CTP) (Mitochondrial citrate carrier) (CIC) (Solute carrier family 25 member 1) (Tricarboxylate carrier protein)	EBI-20625330	0.35
Q9NVU7	Protein SDA1 homolog (Nucleolar protein 130) (SDA1 domain-containing protein 1) (hSDA)	EBI-20625330	0.35
O76021	Ribosomal L1 domain-containing protein 1 (CATX-11) (Cellular senescence-inhibited gene protein) (Protein PBK1)	EBI-20625330	0.35
Q14684	Ribosomal RNA processing protein 1 homolog B (RRP1-like protein B)	EBI-20625330	0.35
P08865	40S ribosomal protein SA (37 kDa laminin receptor precursor) (37LRP) (37/67 kDa laminin receptor) (LRP/LR) (67 kDa laminin receptor) (67LR) (Colon carcinoma laminin-binding protein) (Laminin receptor 1) (LamR) (Laminin-binding protein precursor p40) (LBP/p40) (Multidrug resistance-associated protein MGr1-Ag) (NEM/1CHD4) (Small ribosomal subunit protein uS2)	EBI-20625330	0.35
P46781	40S ribosomal protein S9 (Small ribosomal subunit protein uS4)	EBI-20625330	0.35
P62241	40S ribosomal protein S8 (Small ribosomal subunit protein eS8)	EBI-20625330	0.35
P62081	40S ribosomal protein S7 (Small ribosomal subunit protein eS7)	EBI-20625330	0.35
P62753	40S ribosomal protein S6 (Phosphoprotein NP33) (Small ribosomal subunit protein eS6)	EBI-20625330	0.35
P46782	40S ribosomal protein S5 (Small ribosomal subunit protein uS7) [Cleaved into: 40S ribosomal protein S5, N-terminally processed]	EBI-20625330	0.35
P62701	40S ribosomal protein S4, X isoform (SCR10) (Single copy abundant mRNA protein) (Small ribosomal subunit protein eS4)	EBI-20625330	0.35
P61247	40S ribosomal protein S3a (Small ribosomal subunit protein eS1) (v-fos transformation effector protein) (Fte-1)	EBI-20625330	0.35
P23396	40S ribosomal protein S3 (EC 4.2.99.18) (Small ribosomal subunit protein uS3)	EBI-20625330	0.35
P62273	40S ribosomal protein S29 (Small ribosomal subunit protein uS14)	EBI-20625330	0.35
P62857	40S ribosomal protein S28 (Small ribosomal subunit protein eS28)	EBI-20625330	0.35
P62854	40S ribosomal protein S26 (Small ribosomal subunit protein eS26)	EBI-20625330	0.35
P62851	40S ribosomal protein S25 (Small ribosomal subunit protein eS25)	EBI-20625330	0.35
P62847	40S ribosomal protein S24 (Small ribosomal subunit protein eS24)	EBI-20625330	0.35
P63220	40S ribosomal protein S21 (Small ribosomal subunit protein eS21)	EBI-20625330	0.35
P60866	40S ribosomal protein S20 (Small ribosomal subunit protein uS10)	EBI-20625330	0.35
P15880	40S ribosomal protein S2 (40S ribosomal protein S4) (Protein LLRep3) (Small ribosomal subunit protein uS5)	EBI-20625330	0.35
P39019	40S ribosomal protein S19 (Small ribosomal subunit protein eS19)	EBI-20625330	0.35
P62269	40S ribosomal protein S18 (Ke-3) (Ke3) (Small ribosomal subunit protein uS13)	EBI-20625330	0.35
P08708	40S ribosomal protein S17 (Small ribosomal subunit protein eS17)	EBI-20625330	0.35
P62249	40S ribosomal protein S16 (Small ribosomal subunit protein uS9)	EBI-20625330	0.35
P62244	40S ribosomal protein S15a (Small ribosomal subunit protein uS8)	EBI-20625330	0.35
P62841	40S ribosomal protein S15 (RIG protein) (Small ribosomal subunit protein uS19)	EBI-20625330	0.35
P62277	40S ribosomal protein S13 (Small ribosomal subunit protein uS15)	EBI-20625330	0.35
P25398	40S ribosomal protein S12 (Small ribosomal subunit protein eS12)	EBI-20625330	0.35
P46783	40S ribosomal protein S10 (Small ribosomal subunit protein eS10)	EBI-20625330	0.35
P04843	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit) (Ribophorin I) (RPN-I) (Ribophorin-1)	EBI-20625330	0.35
P05387	60S acidic ribosomal protein P2 (Large ribosomal subunit protein P2) (Renal carcinoma antigen NY-REN-44)	EBI-20625330	0.35
Q6FG99	RPLP1 protein	EBI-20625330	0.35
P05388	60S acidic ribosomal protein P0 (60S ribosomal protein L10E) (Large ribosomal subunit protein uL10)	EBI-20625330	0.35
P32969	60S ribosomal protein L9 (Large ribosomal subunit protein uL6)	EBI-20625330	0.35
P62917	60S ribosomal protein L8 (Large ribosomal subunit protein uL2)	EBI-20625330	0.35
P62424	60S ribosomal protein L7a (Large ribosomal subunit protein eL8) (PLA-X polypeptide) (Surfeit locus protein 3)	EBI-20625330	0.35
P18124	60S ribosomal protein L7 (Large ribosomal subunit protein uL30)	EBI-20625330	0.35
Q02878	60S ribosomal protein L6 (Large ribosomal subunit protein eL6) (Neoplasm-related protein C140) (Tax-responsive enhancer element-binding protein 107) (TaxREB107)	EBI-20625330	0.35
P46777	60S ribosomal protein L5 (Large ribosomal subunit protein uL18)	EBI-20625330	0.35
P36578	60S ribosomal protein L4 (60S ribosomal protein L1) (Large ribosomal subunit protein uL4)	EBI-20625330	0.35
P63173	60S ribosomal protein L38 (Large ribosomal subunit protein eL38)	EBI-20625330	0.35
Q969Q0	60S ribosomal protein L36a-like (Large ribosomal subunit protein eL42-like)	EBI-20625330	0.35
Q9Y3U8	60S ribosomal protein L36 (Large ribosomal subunit protein eL36)	EBI-20625330	0.35
P18077	60S ribosomal protein L35a (Cell growth-inhibiting gene 33 protein) (Large ribosomal subunit protein eL33)	EBI-20625330	0.35
P42766	60S ribosomal protein L35 (Large ribosomal subunit protein uL29)	EBI-20625330	0.35
P49207	60S ribosomal protein L34 (Large ribosomal subunit protein eL34)	EBI-20625330	0.35
P62910	60S ribosomal protein L32 (Large ribosomal subunit protein eL32)	EBI-20625330	0.35
P62899	60S ribosomal protein L31 (Large ribosomal subunit protein eL31)	EBI-20625330	0.35
P62888	60S ribosomal protein L30 (Large ribosomal subunit protein eL30)	EBI-20625330	0.35
P39023	60S ribosomal protein L3 (HIV-1 TAR RNA-binding protein B) (TARBP-B) (Large ribosomal subunit protein uL3)	EBI-20625330	0.35
P47914	60S ribosomal protein L29 (Cell surface heparin-binding protein HIP) (Large ribosomal subunit protein eL29)	EBI-20625330	0.35
P46779	60S ribosomal protein L28 (Large ribosomal subunit protein eL28)	EBI-20625330	0.35
P46776	60S ribosomal protein L27a (Large ribosomal subunit protein uL15)	EBI-20625330	0.35
P61353	60S ribosomal protein L27 (Large ribosomal subunit protein eL27)	EBI-20625330	0.35
Q9UNX3	60S ribosomal protein L26-like 1 (Large ribosomal subunit protein uL24-like 1)	EBI-20625330	0.35
P61254	60S ribosomal protein L26 (Large ribosomal subunit protein uL24)	EBI-20625330	0.35
P83731	60S ribosomal protein L24 (60S ribosomal protein L30) (Large ribosomal subunit protein eL24)	EBI-20625330	0.35
P62750	60S ribosomal protein L23a (Large ribosomal subunit protein uL23)	EBI-20625330	0.35
P62829	60S ribosomal protein L23 (60S ribosomal protein L17) (Large ribosomal subunit protein uL14)	EBI-20625330	0.35
P35268	60S ribosomal protein L22 (EBER-associated protein) (EAP) (Epstein-Barr virus small RNA-associated protein) (Heparin-binding protein HBp15) (Large ribosomal subunit protein eL22)	EBI-20625330	0.35
P46778	60S ribosomal protein L21 (Large ribosomal subunit protein eL21)	EBI-20625330	0.35
P84098	60S ribosomal protein L19 (Large ribosomal subunit protein eL19)	EBI-20625330	0.35
Q02543	60S ribosomal protein L18a (Large ribosomal subunit protein eL20)	EBI-20625330	0.35
Q07020	60S ribosomal protein L18 (Large ribosomal subunit protein eL18)	EBI-20625330	0.35
P18621	60S ribosomal protein L17 (60S ribosomal protein L23) (Large ribosomal subunit protein uL22) (PD-1)	EBI-20625330	0.35
P61313	60S ribosomal protein L15 (Large ribosomal subunit protein eL15)	EBI-20625330	0.35
P50914	60S ribosomal protein L14 (CAG-ISL 7) (Large ribosomal subunit protein eL14)	EBI-20625330	0.35
P40429	60S ribosomal protein L13a (23 kDa highly basic protein) (Large ribosomal subunit protein uL13)	EBI-20625330	0.35
P26373	60S ribosomal protein L13 (Breast basic conserved protein 1) (Large ribosomal subunit protein eL13)	EBI-20625330	0.35
P30050	60S ribosomal protein L12 (Large ribosomal subunit protein uL11)	EBI-20625330	0.35
P62913	60S ribosomal protein L11 (CLL-associated antigen KW-12) (Large ribosomal subunit protein uL5)	EBI-20625330	0.35
P27635	60S ribosomal protein L10 (Laminin receptor homolog) (Large ribosomal subunit protein uL16) (Protein QM) (Ribosomal protein L10) (Tumor suppressor QM)	EBI-20625330	0.35
Q14257	Reticulocalbin-2 (Calcium-binding protein ERC-55) (E6-binding protein) (E6BP)	EBI-20625330	0.35
P42696	RNA-binding protein 34 (RNA-binding motif protein 34)	EBI-20625330	0.35
Q9NW13	RNA-binding protein 28 (RNA-binding motif protein 28)	EBI-20625330	0.35
Q96EY7	Pentatricopeptide repeat domain-containing protein 3, mitochondrial (28S ribosomal protein S39, mitochondrial) (MRP-S39) (Mitochondrial small ribosomal subunit protein mS39) (Transformation-related gene 15 protein) (TRG-15)	EBI-20625330	0.35
P56730	Neurotrypsin (EC 3.4.21.-) (Leydin) (Motopsin) (Serine protease 12)	EBI-20625330	0.35
P78527	DNA-dependent protein kinase catalytic subunit (DNA-PK catalytic subunit) (DNA-PKcs) (EC 2.7.11.1) (DNPK1) (p460)	EBI-20625330	0.35
O15355	Protein phosphatase 1G (EC 3.1.3.16) (Protein phosphatase 1C) (Protein phosphatase 2C isoform gamma) (PP2C-gamma) (Protein phosphatase magnesium-dependent 1 gamma)	EBI-20625330	0.35
Q9NQ55	Suppressor of SWI4 1 homolog (Ssf-1) (Brix domain-containing protein 3) (Peter Pan homolog)	EBI-20625330	0.35
Q99575	Ribonucleases P/MRP protein subunit POP1 (hPOP1)	EBI-20625330	0.35
P40855	Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin-19) (Peroxisomal farnesylated protein)	EBI-20625330	0.35
O00408	cGMP-dependent 3',5'-cyclic phosphodiesterase (EC 3.1.4.17) (Cyclic GMP-stimulated phosphodiesterase) (CGS-PDE) (cGSPDE)	EBI-20625330	0.35
O00567	Nucleolar protein 56 (Nucleolar protein 5A)	EBI-20625330	0.35
Q9H6R4	Nucleolar protein 6 (Nucleolar RNA-associated protein) (Nrap)	EBI-20625330	0.35
Q9BYG3	MKI67 FHA domain-interacting nucleolar phosphoprotein (Nucleolar phosphoprotein Nopp34) (Nucleolar protein interacting with the FHA domain of pKI-67) (hNIFK)	EBI-20625330	0.35
Q8NEJ9	Neuroguidin (Centromere accumulated nuclear protein 1) (CANu1) (EIF4E-binding protein)	EBI-20625330	0.50
P19338	Nucleolin (Protein C23)	EBI-20625330	0.35
Q9H0A0	RNA cytidine acetyltransferase (EC 2.3.1.-) (18S rRNA cytosine acetyltransferase) (N-acetyltransferase 10) (N-acetyltransferase-like protein) (hALP)	EBI-20625330	0.35
Q99733	Nucleosome assembly protein 1-like 4 (Nucleosome assembly protein 2) (NAP-2)	EBI-20625330	0.35
F8W118	Nucleosome assembly protein 1-like 1	EBI-20625330	0.35
P55209	Nucleosome assembly protein 1-like 1 (NAP-1-related protein) (hNRP)	EBI-20625330	0.35
Q9BQG0	Myb-binding protein 1A	EBI-20625330	0.35
P52701	DNA mismatch repair protein Msh6 (hMSH6) (G/T mismatch-binding protein) (GTBP) (GTMBP) (MutS protein homolog 6) (MutS-alpha 160 kDa subunit) (p160)	EBI-20625330	0.35
Q9UKD2	mRNA turnover protein 4 homolog (Ribosome assembly factor MRTO4)	EBI-20625330	0.35
P82933	28S ribosomal protein S9, mitochondrial (MRP-S9) (S9mt) (Mitochondrial small ribosomal subunit protein uS9m)	EBI-20625330	0.35
Q9Y2R9	28S ribosomal protein S7, mitochondrial (MRP-S7) (S7mt) (Mitochondrial small ribosomal subunit protein uS7m) (bMRP-27a) (bMRP27a)	EBI-20625330	0.35
P82932	28S ribosomal protein S6, mitochondrial (MRP-S6) (S6mt) (Mitochondrial small ribosomal subunit protein bS6m)	EBI-20625330	0.35
P82675	28S ribosomal protein S5, mitochondrial (MRP-S5) (S5mt) (Mitochondrial small ribosomal subunit protein uS5m)	EBI-20625330	0.35
P82673	28S ribosomal protein S35, mitochondrial (MRP-S35) (S35mt) (28S ribosomal protein S28, mitochondrial) (MRP-S28) (S28mt) (Mitochondrial small ribosomal subunit protein mS35)	EBI-20625330	0.35
P82930	28S ribosomal protein S34, mitochondrial (MRP-S34) (S34mt) (Mitochondrial small ribosomal subunit protein mS34)	EBI-20625330	0.35
Q9Y291	28S ribosomal protein S33, mitochondrial (MRP-S33) (S33mt) (Mitochondrial small ribosomal subunit protein mS33)	EBI-20625330	0.35
Q92665	28S ribosomal protein S31, mitochondrial (MRP-S31) (S31mt) (Imogen 38) (Mitochondrial small ribosomal subunit protein mS31)	EBI-20625330	0.35
Q9NP92	39S ribosomal protein S30, mitochondrial (MRP-S30) (S30mt) (Mitochondrial large ribosomal subunit protein mL65) (Mitochondrial large ribosomal subunit protein mS30) (Programmed cell death protein 9)	EBI-20625330	0.35
Q9Y2Q9	28S ribosomal protein S28, mitochondrial (MRP-S28) (S28mt) (28S ribosomal protein S35, mitochondrial) (MRP-S35) (S35mt) (Mitochondrial small ribosomal subunit protein bS1m)	EBI-20625330	0.35
Q92552	28S ribosomal protein S27, mitochondrial (MRP-S27) (S27mt) (Mitochondrial ribosomal protein S27) (Mitochondrial small ribosomal subunit protein mS27)	EBI-20625330	0.35
Q9BYN8	28S ribosomal protein S26, mitochondrial (MRP-S26) (S26mt) (28S ribosomal protein S13, mitochondrial) (MRP-S13) (S13mt) (Mitochondrial small ribosomal subunit protein mS26)	EBI-20625330	0.35
P82663	28S ribosomal protein S25, mitochondrial (MRP-S25) (S25mt) (Mitochondrial small ribosomal subunit protein mS25)	EBI-20625330	0.35
Q9Y3D9	28S ribosomal protein S23, mitochondrial (MRP-S23) (S23mt) (Mitochondrial small ribosomal subunit protein mS23)	EBI-20625330	0.35
P82650	28S ribosomal protein S22, mitochondrial (MRP-S22) (S22mt) (Mitochondrial small ribosomal subunit protein mS22)	EBI-20625330	0.35
P82921	28S ribosomal protein S21, mitochondrial (MRP-S21) (S21mt) (Mitochondrial small ribosomal subunit protein bS21m)	EBI-20625330	0.35
Q9Y399	28S ribosomal protein S2, mitochondrial (MRP-S2) (S2mt) (Mitochondrial small ribosomal subunit protein uS2m)	EBI-20625330	0.35
Q9Y3D3	28S ribosomal protein S16, mitochondrial (MRP-S16) (S16mt) (Mitochondrial small ribosomal subunit protein bS16m)	EBI-20625330	0.35
P82914	28S ribosomal protein S15, mitochondrial (MRP-S15) (S15mt) (Mitochondrial small ribosomal subunit protein uS15m)	EBI-20625330	0.35
O60783	28S ribosomal protein S14, mitochondrial (MRP-S14) (S14mt) (Mitochondrial small ribosomal subunit protein uS14m)	EBI-20625330	0.35
P82912	28S ribosomal protein S11, mitochondrial (MRP-S11) (S11mt) (Cervical cancer proto-oncogene 2 protein) (HCC-2) (Mitochondrial small ribosomal subunit protein uS11m)	EBI-20625330	0.35
P82664	28S ribosomal protein S10, mitochondrial (MRP-S10) (S10mt) (Mitochondrial small ribosomal subunit protein uS10m)	EBI-20625330	0.35
Q9BYD2	39S ribosomal protein L9, mitochondrial (L9mt) (MRP-L9) (Mitochondrial large ribosomal subunit protein bL9m)	EBI-20625330	0.35
Q9HD33	39S ribosomal protein L47, mitochondrial (L47mt) (MRP-L47) (Mitochondrial large ribosomal subunit protein uL29m) (Nasopharyngeal carcinoma metastasis-related protein 1)	EBI-20625330	0.35
Q9BRJ2	39S ribosomal protein L45, mitochondrial (L45mt) (MRP-L45) (Mitochondrial large ribosomal subunit protein mL45)	EBI-20625330	0.35
Q9Y6G3	39S ribosomal protein L42, mitochondrial (L42mt) (MRP-L42) (39S ribosomal protein L31, mitochondrial) (L31mt) (MRP-L31) (Mitochondrial large ribosomal subunit protein mL42)	EBI-20625330	0.35
Q8IXM3	39S ribosomal protein L41, mitochondrial (L41mt) (MRP-L41) (39S ribosomal protein L27 homolog) (Bcl-2-interacting mitochondrial ribosomal protein L41) (Cell proliferation-inducing gene 3 protein) (MRP-L27 homolog) (Mitochondrial large ribosomal subunit protein mL41)	EBI-20625330	0.35
Q9NYK5	39S ribosomal protein L39, mitochondrial (L39mt) (MRP-L39) (39S ribosomal protein L5, mitochondrial) (L5mt) (MRP-L5) (Mitochondrial large ribosomal subunit protein mL39)	EBI-20625330	0.35
Q96DV4	39S ribosomal protein L38, mitochondrial (L38mt) (MRP-L38) (Mitochondrial large ribosomal subunit protein mL38)	EBI-20625330	0.35
Q9BZE1	39S ribosomal protein L37, mitochondrial (L37mt) (MRP-L37) (39S ribosomal protein L2, mitochondrial) (L2mt) (MRP-L2) (Mitochondrial large ribosomal subunit protein mL37)	EBI-20625330	0.35
Q9NZE8	39S ribosomal protein L35, mitochondrial (L35mt) (MRP-L35) (Mitochondrial large ribosomal subunit protein bL35m)	EBI-20625330	0.35
P09001	39S ribosomal protein L3, mitochondrial (L3mt) (MRP-L3) (Mitochondrial large ribosomal subunit protein uL3m)	EBI-20625330	0.35
Q13084	39S ribosomal protein L28, mitochondrial (L28mt) (MRP-L28) (Melanoma antigen p15) (Melanoma-associated antigen recognized by T-lymphocytes) (Mitochondrial large ribosomal subunit protein bL28m)	EBI-20625330	0.35
Q96A35	39S ribosomal protein L24, mitochondrial (L24mt) (MRP-L24) (Mitochondrial large ribosomal subunit protein uL24m)	EBI-20625330	0.35
Q16540	39S ribosomal protein L23, mitochondrial (L23mt) (MRP-L23) (L23 mitochondrial-related protein) (Mitochondrial large ribosomal subunit protein uL23m) (Ribosomal protein L23-like)	EBI-20625330	0.35
Q9NWU5	39S ribosomal protein L22, mitochondrial (L22mt) (MRP-L22) (39S ribosomal protein L25, mitochondrial) (L25mt) (MRP-L25) (Mitochondrial large ribosomal subunit protein uL22m)	EBI-20625330	0.35
Q7Z2W9	39S ribosomal protein L21, mitochondrial (L21mt) (MRP-L21) (Mitochondrial large ribosomal subunit protein bL21m)	EBI-20625330	0.35
Q5T653	39S ribosomal protein L2, mitochondrial (L2mt) (MRP-L2) (Mitochondrial large ribosomal subunit protein uL2m)	EBI-20625330	0.35
P49406	39S ribosomal protein L19, mitochondrial (L19mt) (MRP-L19) (39S ribosomal protein L15, mitochondrial) (L15mt) (MRP-L15) (Mitochondrial large ribosomal subunit protein bL19m)	EBI-20625330	0.35
Q9H0U6	39S ribosomal protein L18, mitochondrial (L18mt) (MRP-L18) (Mitochondrial large ribosomal subunit protein uL18m)	EBI-20625330	0.35
Q9NX20	39S ribosomal protein L16, mitochondrial (L16mt) (MRP-L16) (Mitochondrial large ribosomal subunit protein uL16m)	EBI-20625330	0.35
Q9BYD1	39S ribosomal protein L13, mitochondrial (L13mt) (MRP-L13) (Mitochondrial large ribosomal subunit protein uL13m)	EBI-20625330	0.35
Q9Y3B7	39S ribosomal protein L11, mitochondrial (L11mt) (MRP-L11) (Mitochondrial large ribosomal subunit protein uL11m)	EBI-20625330	0.35
Q7Z7H8	39S ribosomal protein L10, mitochondrial (L10mt) (MRP-L10) (39S ribosomal protein L8, mitochondrial) (L8mt) (MRP-L8) (Mitochondrial large ribosomal subunit protein uL10m)	EBI-20625330	0.35
Q9BYD6	39S ribosomal protein L1, mitochondrial (L1mt) (MRP-L1) (Mitochondrial large ribosomal subunit protein uL1m)	EBI-20625330	0.35
Q9Y5V3	Melanoma-associated antigen D1 (MAGE tumor antigen CCF) (MAGE-D1 antigen) (Neurotrophin receptor-interacting MAGE homolog)	EBI-20625330	0.35
Q9NX58	Cell growth-regulating nucleolar protein	EBI-20625330	0.50
Q9BRT6	Protein LLP homolog (Protein LAPS18-like)	EBI-20625330	0.35
Q4G0J3	La-related protein 7 (La ribonucleoprotein domain family member 7) (hLARP7) (P-TEFb-interaction protein for 7SK stability) (PIP7S)	EBI-20625330	0.50
Q6PKG0	La-related protein 1 (La ribonucleoprotein domain family member 1)	EBI-20625330	0.35
Q13601	KRR1 small subunit processome component homolog (HIV-1 Rev-binding protein 2) (KRR-R motif-containing protein 1) (Rev-interacting protein 1) (Rip-1)	EBI-20625330	0.35
Q8N9T8	Protein KRI1 homolog	EBI-20625330	0.35
Q15397	Pumilio homolog 3 (HBV X-transactivated gene 5 protein) (HBV XAg-transactivated protein 5) (Minor histocompatibility antigen HA-8) (HLA-HA8)	EBI-20625330	0.35
Q96P70	Importin-9 (Imp9) (Ran-binding protein 9) (RanBP9)	EBI-20625330	0.35
O95373	Importin-7 (Imp7) (Ran-binding protein 7) (RanBP7)	EBI-20625330	0.35
Q14197	Peptidyl-tRNA hydrolase ICT1, mitochondrial (EC 3.1.1.29) (39S ribosomal protein L58, mitochondrial) (MRP-L58) (Digestion substraction 1) (DS-1) (Immature colon carcinoma transcript 1 protein) (Mitochondrial large ribosomal subunit protein mL62)	EBI-20625330	0.35
Q5SSJ5	Heterochromatin protein 1-binding protein 3 (Protein HP1-BP74)	EBI-20625330	0.35
Q00341	Vigilin (High density lipoprotein-binding protein) (HDL-binding protein)	EBI-20625330	0.35
P55084	Trifunctional enzyme subunit beta, mitochondrial (TP-beta) [Includes: 3-ketoacyl-CoA thiolase (EC 2.3.1.155) (EC 2.3.1.16) (Acetyl-CoA acyltransferase) (Beta-ketothiolase)]	EBI-20625330	0.35
P40939	Trifunctional enzyme subunit alpha, mitochondrial (78 kDa gastrin-binding protein) (Monolysocardiolipin acyltransferase) (EC 2.3.1.-) (TP-alpha) [Includes: Long-chain enoyl-CoA hydratase (EC 4.2.1.17); Long chain 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.211)]	EBI-20625330	0.35
Q9P035	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 (EC 4.2.1.134) (3-hydroxyacyl-CoA dehydratase 3) (HACD3) (Butyrate-induced protein 1) (B-ind1) (hB-ind1) (Protein-tyrosine phosphatase-like A domain-containing protein 1)	EBI-20625330	0.35
Q92522	Histone H1.10 (Histone H1x)	EBI-20625330	0.35
Q9BZE4	GTP-binding protein 4 (Chronic renal failure gene protein) (GTP-binding protein NGB) (Nucleolar GTP-binding protein 1)	EBI-20625330	0.35
Q8WUA4	General transcription factor 3C polypeptide 2 (TF3C-beta) (Transcription factor IIIC 110 kDa subunit) (TFIIIC 110 kDa subunit) (TFIIIC110) (Transcription factor IIIC subunit beta)	EBI-20625330	0.35
Q9BQ67	Glutamate-rich WD repeat-containing protein 1	EBI-20625330	0.35
Q5JY77	G-protein coupled receptor-associated sorting protein 1 (GASP-1)	EBI-20625330	0.35
A0A024R2Z6	Guanine nucleotide-binding protein-like 3	EBI-20625330	0.35
Q13823	Nucleolar GTP-binding protein 2 (Autoantigen NGP-1)	EBI-20625330	0.35
Q8WXD5	Gem-associated protein 6 (Gemin-6) (SIP2)	EBI-20625330	0.35
Q9HBB9	HC56	EBI-20625330	0.35
Q8IY81	pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 (EC 2.1.1.-) (Protein ftsJ homolog 3) (Putative rRNA methyltransferase 3)	EBI-20625330	0.35
P62861	FAU ubiquitin-like and ribosomal protein S30 [Cleaved into: Ubiquitin-like protein FUBI; 40S ribosomal protein S30 (Small ribosomal subunit protein eS30)]	EBI-20625330	0.35
Q06265	Exosome complex component RRP45 (Autoantigen PM/Scl 1) (Exosome component 9) (P75 polymyositis-scleroderma overlap syndrome-associated autoantigen) (Polymyositis/scleroderma autoantigen 1) (Polymyositis/scleroderma autoantigen 75 kDa) (PM/Scl-75)	EBI-20625330	0.35
Q9NPD3	Exosome complex component RRP41 (Exosome component 4) (Ribosomal RNA-processing protein 41) (p12A)	EBI-20625330	0.35
Q01780	Exosome component 10 (EC 3.1.13.-) (Autoantigen PM/Scl 2) (P100 polymyositis-scleroderma overlap syndrome-associated autoantigen) (Polymyositis/scleroderma autoantigen 100 kDa) (PM/Scl-100) (Polymyositis/scleroderma autoantigen 2)	EBI-20625330	0.35
Q9Y3B2	Exosome complex component CSL4 (Exosome component 1)	EBI-20625330	0.35
O75616	GTPase Era, mitochondrial (H-ERA) (hERA) (Conserved ERA-like GTPase) (CEGA) (ERA-W) (ERA-like protein 1)	EBI-20625330	0.35
Q9NR50	Translation initiation factor eIF-2B subunit gamma (eIF-2B GDP-GTP exchange factor subunit gamma)	EBI-20625330	0.35
Q99848	Probable rRNA-processing protein EBP2 (EBNA1-binding protein 2) (Nucleolar protein p40)	EBI-20625330	0.35
Q8WXX5	DnaJ homolog subfamily C member 9 (HDJC9) (DnaJ protein SB73)	EBI-20625330	0.35
O60884	DnaJ homolog subfamily A member 2 (Cell cycle progression restoration gene 3 protein) (Dnj3) (Dj3) (HIRA-interacting protein 4) (Renal carcinoma antigen NY-REN-14)	EBI-20625330	0.35
O60832	H/ACA ribonucleoprotein complex subunit DKC1 (EC 5.4.99.-) (CBF5 homolog) (Dyskerin) (Nopp140-associated protein of 57 kDa) (Nucleolar protein NAP57) (Nucleolar protein family A member 4) (snoRNP protein DKC1)	EBI-20625330	0.35
Q9UNQ2	Probable dimethyladenosine transferase (EC 2.1.1.183) (DIM1 dimethyladenosine transferase 1 homolog) (DIM1 dimethyladenosine transferase 1-like) (Probable 18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase) (Probable 18S rRNA dimethylase) (Probable S-adenosylmethionine-6-N',N'-adenosyl(rRNA) dimethyltransferase)	EBI-20625330	0.35
Q6P158	Putative ATP-dependent RNA helicase DHX57 (EC 3.6.4.13) (DEAH box protein 57)	EBI-20625330	0.35
Q9BQ39	ATP-dependent RNA helicase DDX50 (EC 3.6.4.13) (DEAD box protein 50) (Gu-beta) (Nucleolar protein Gu2)	EBI-20625330	0.35
O15523	ATP-dependent RNA helicase DDX3Y (EC 3.6.4.13) (DEAD box protein 3, Y-chromosomal)	EBI-20625330	0.35
Q9GZR7	ATP-dependent RNA helicase DDX24 (EC 3.6.4.13) (DEAD box protein 24)	EBI-20625330	0.35
Q9NR30	Nucleolar RNA helicase 2 (EC 3.6.4.13) (DEAD box protein 21) (Gu-alpha) (Nucleolar RNA helicase Gu) (Nucleolar RNA helicase II) (RH II/Gu)	EBI-20625330	0.35
Q9UHI6	Probable ATP-dependent RNA helicase DDX20 (EC 3.6.1.15) (EC 3.6.4.13) (Component of gems 3) (DEAD box protein 20) (DEAD box protein DP 103) (Gemin-3)	EBI-20625330	0.35
Q9NVP1	ATP-dependent RNA helicase DDX18 (EC 3.6.4.13) (DEAD box protein 18) (Myc-regulated DEAD box protein) (MrDb)	EBI-20625330	0.35
Q13206	Probable ATP-dependent RNA helicase DDX10 (EC 3.6.4.13) (DEAD box protein 10)	EBI-20625330	0.35
Q16531	DNA damage-binding protein 1 (DDB p127 subunit) (DNA damage-binding protein a) (DDBa) (Damage-specific DNA-binding protein 1) (HBV X-associated protein 1) (XAP-1) (UV-damaged DNA-binding factor) (UV-damaged DNA-binding protein 1) (UV-DDB 1) (XPE-binding factor) (XPE-BF) (Xeroderma pigmentosum group E-complementing protein) (XPCe)	EBI-20625330	0.35
P51398	28S ribosomal protein S29, mitochondrial (MRP-S29) (S29mt) (Death-associated protein 3) (DAP-3) (Ionizing radiation resistance conferring protein) (Mitochondrial small ribosomal subunit protein mS29)	EBI-20625330	0.35
Q9BQ75	Protein CMSS1 (Cms1 ribosomal small subunit homolog)	EBI-20625330	0.35
B2R5U7	cDNA, FLJ92633, highly similar to Homo sapiens CCAAT-box-binding transcription factor (CBF2), mRNA	EBI-20625330	0.35
Q6PK04	Coiled-coil domain-containing protein 137	EBI-20625330	0.35
Q13555	Calcium/calmodulin-dependent protein kinase type II subunit gamma (CaM kinase II subunit gamma) (CaMK-II subunit gamma) (EC 2.7.11.17)	EBI-20625330	0.35
P62158	Calmodulin-1	EBI-20625330	0.35
Q9BRJ6	Uncharacterized protein C7orf50	EBI-20625330	0.35
Q8TDN6	Ribosome biogenesis protein BRX1 homolog (Brix domain-containing protein 2)	EBI-20625330	0.35
Q14137	Ribosome biogenesis protein BOP1 (Block of proliferation 1 protein)	EBI-20625330	0.35
Q14692	Ribosome biogenesis protein BMS1 homolog (Ribosome assembly protein BMS1 homolog)	EBI-20625330	0.35
P16615	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2) (SR Ca(2+)-ATPase 2) (EC 7.2.2.10) (Calcium pump 2) (Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform) (Endoplasmic reticulum class 1/2 Ca(2+) ATPase)	EBI-20625330	0.35
Q6NT76	Homeobox-containing protein 1 (Homeobox telomere-binding protein 1) (Telomere-associated homeobox-containing protein 1)	EBI-20625829	0.40
O60613	Selenoprotein F (15 kDa selenoprotein)	EBI-20626156	0.35
O14967	Calmegin	EBI-20626156	0.35
Q13315	Serine-protein kinase ATM (EC 2.7.11.1) (Ataxia telangiectasia mutated) (A-T mutated)	EBI-20626076	0.35
P04350	Tubulin beta-4A chain (Tubulin 5 beta) (Tubulin beta-4 chain)	EBI-20626076	0.35
Q9NZ01	Very-long-chain enoyl-CoA reductase (EC 1.3.1.93) (Synaptic glycoprotein SC2) (Trans-2,3-enoyl-CoA reductase) (TER)	EBI-20626076	0.35
Q02978	Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP) (alpha-oxoglutarate carrier) (Solute carrier family 25 member 11) (SLC25A11)	EBI-20626076	0.35
Q29RF7	Sister chromatid cohesion protein PDS5 homolog A (Cell proliferation-inducing gene 54 protein) (Sister chromatid cohesion protein 112) (SCC-112)	EBI-20626076	0.35
B3KY51	cDNA FLJ46863 fis, clone UTERU3011558	EBI-20626076	0.35
Q92604	Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 (Acyl-CoA:monoacylglycerol acyltransferase LPGAT1) (EC 2.3.1.22) (Lysophospholipid acyltransferase 7) (LPLAT7) (EC 2.3.1.-) (Stearoyl-CoA:1-lyso-2-acyl-PE acyltransferase)	EBI-20626076	0.35
A0A024R3R5	Delta(14)-sterol reductase LBR (EC 1.3.1.70) (3-beta-hydroxysterol Delta (14)-reductase) (C-14 sterol reductase) (Integral nuclear envelope inner membrane protein) (Lamin-B receptor) (Sterol C14-reductase)	EBI-20626076	0.35
Q8WVX9	Fatty acyl-CoA reductase 1 (EC 1.2.1.84) (Male sterility domain-containing protein 2)	EBI-20626076	0.35
O95864	Acyl-CoA 6-desaturase (EC 1.14.19.3) (Delta(6) fatty acid desaturase) (D6D) (Delta(6) desaturase) (Delta-6 desaturase) (Fatty acid desaturase 2)	EBI-20626076	0.35
O94905	Erlin-2 (Endoplasmic reticulum lipid raft-associated protein 2) (Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2) (SPFH domain-containing protein 2)	EBI-20626076	0.35
O75477	Erlin-1 (Endoplasmic reticulum lipid raft-associated protein 1) (Protein KE04) (Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 1) (SPFH domain-containing protein 1)	EBI-20626076	0.35
P11532	Dystrophin	EBI-20626076	0.35
Q96MT8	Centrosomal protein of 63 kDa (Cep63)	EBI-20626076	0.35
P27824	Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90)	EBI-20626076	0.35
P58397	A disintegrin and metalloproteinase with thrombospondin motifs 12 (ADAM-TS 12) (ADAM-TS12) (ADAMTS-12) (EC 3.4.24.-)	EBI-20626076	0.35
Q13442	28 kDa heat- and acid-stable phosphoprotein (PDGF-associated protein) (PAP) (PDGFA-associated protein 1) (PAP1)	EBI-20626135	0.35
Q9UGN5	Poly [ADP-ribose] polymerase 2 (PARP-2) (hPARP-2) (EC 2.4.2.30) (ADP-ribosyltransferase diphtheria toxin-like 2) (ARTD2) (DNA ADP-ribosyltransferase PARP2) (EC 2.4.2.-) (NAD(+) ADP-ribosyltransferase 2) (ADPRT-2) (Poly[ADP-ribose] synthase 2) (pADPRT-2) (Protein poly-ADP-ribosyltransferase PARP2) (EC 2.4.2.-)	EBI-20626135	0.35
Q9HCK8	Chromodomain-helicase-DNA-binding protein 8 (CHD-8) (EC 3.6.4.12) (ATP-dependent helicase CHD8) (Helicase with SNF2 domain 1)	EBI-20626135	0.35
Q9BSJ8	Extended synaptotagmin-1 (E-Syt1) (Membrane-bound C2 domain-containing protein)	EBI-20626240	0.40
P45880	Voltage-dependent anion-selective channel protein 2 (VDAC-2) (hVDAC2) (Outer mitochondrial membrane protein porin 2)	EBI-20626197	0.35
O14925	Mitochondrial import inner membrane translocase subunit Tim23	EBI-20626197	0.35
O15260	Surfeit locus protein 4	EBI-20626197	0.35
P46977	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A (Oligosaccharyl transferase subunit STT3A) (STT3-A) (EC 2.4.99.18) (B5) (Integral membrane protein 1) (Transmembrane protein TMC)	EBI-20626197	0.35
Q9UNL2	Translocon-associated protein subunit gamma (TRAP-gamma) (Signal sequence receptor subunit gamma) (SSR-gamma)	EBI-20626197	0.35
O15269	Serine palmitoyltransferase 1 (EC 2.3.1.50) (Long chain base biosynthesis protein 1) (LCB 1) (Serine-palmitoyl-CoA transferase 1) (SPT 1) (SPT1)	EBI-20626197	0.35
P60468	Protein transport protein Sec61 subunit beta	EBI-20626197	0.35
O00767	Stearoyl-CoA desaturase (hSCD1) (EC 1.14.19.1) (Acyl-CoA desaturase) (Delta(9)-desaturase) (Delta-9 desaturase) (Fatty acid desaturase)	EBI-20626197	0.50
Q99623	Prohibitin-2 (B-cell receptor-associated protein BAP37) (D-prohibitin) (Repressor of estrogen receptor activity)	EBI-20626197	0.35
P35232	Prohibitin 1	EBI-20626197	0.35
O60725	Protein-S-isoprenylcysteine O-methyltransferase (EC 2.1.1.100) (Isoprenylcysteine carboxylmethyltransferase) (Prenylated protein carboxyl methyltransferase) (PPMT) (Prenylcysteine carboxyl methyltransferase) (pcCMT)	EBI-20626197	0.35
Q86UL3	Glycerol-3-phosphate acyltransferase 4 (EC 2.3.1.15) (1-acylglycerol-3-phosphate O-acyltransferase 6) (1-AGP acyltransferase 6) (1-AGPAT 6) (Acyl-CoA:glycerol-3-phosphate acyltransferase 4) (Lysophosphatidic acid acyltransferase zeta) (LPAAT-zeta) (Testis spermatogenesis apoptosis-related protein 7) (TSARG7)	EBI-20626197	0.35
P62877	E3 ubiquitin-protein ligase RBX1 (EC 2.3.2.27) (EC 2.3.2.32) (E3 ubiquitin-protein transferase RBX1) (Protein ZYP) (RING finger protein 75) (RING-box protein 1) (Rbx1) (Regulator of cullins 1) (ROC1) [Cleaved into: E3 ubiquitin-protein ligase RBX1, N-terminally processed (E3 ubiquitin-protein transferase RBX1, N-terminally processed)]	EBI-20626169	0.35
Q13126	S-methyl-5'-thioadenosine phosphorylase (EC 2.4.2.28) (5'-methylthioadenosine phosphorylase) (MTA phosphorylase) (MTAP) (MTAPase)	EBI-20626169	0.35
Q969M3	Protein YIPF5 (Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5) (Smooth muscle cell-associated protein 5) (SMAP-5) (YIP1 family member 5) (YPT-interacting protein 1 A)	EBI-20626314	0.35
Q9H2V7	Protein spinster homolog 1 (HSpin1) (Spinster-like protein 1)	EBI-20626314	0.35
P00403	Cytochrome c oxidase subunit 2 (EC 7.1.1.9) (Cytochrome c oxidase polypeptide II)	EBI-20626314	0.35
Q9Y6C9	Mitochondrial carrier homolog 2 (Met-induced mitochondrial protein)	EBI-20626314	0.35
Q9GZP9	Derlin-2 (Degradation in endoplasmic reticulum protein 2) (DERtrin-2) (Der1-like protein 2) (F-LAN-1) (F-LANa)	EBI-20626314	0.35
Q9NWW5	Ceroid-lipofuscinosis neuronal protein 6 (Protein CLN6)	EBI-20626314	0.54
O95070	Protein YIF1A (54TMp) (YIP1-interacting factor homolog A)	EBI-20626314	0.35
Q8NBI6	Xyloside xylosyltransferase 1 (EC 2.4.2.62) (UDP-xylose:alpha-xyloside alpha-1,3-xylosyltransferase)	EBI-20626314	0.35
Q9Y277	Voltage-dependent anion-selective channel protein 3 (VDAC-3) (hVDAC3) (Outer mitochondrial membrane protein porin 3)	EBI-20626314	0.35
P21796	Voltage-dependent anion-selective channel protein 1 (VDAC-1) (hVDAC1) (Outer mitochondrial membrane protein porin 1) (Plasmalemmal porin) (Porin 31HL) (Porin 31HM)	EBI-20626314	0.35
O95292	Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C)	EBI-20626314	0.35
Q96IX5	ATP synthase membrane subunit K, mitochondrial (ATP synthase membrane subunit DAPIT, mitochondrial) (Diabetes-associated protein in insulin-sensitive tissues) (HCV F-transactivated protein 2) (Up-regulated during skeletal muscle growth protein 5)	EBI-20626314	0.35
Q71U36	Tubulin alpha-1A chain (EC 3.6.5.-) (Alpha-tubulin 3) (Tubulin B-alpha-1) (Tubulin alpha-3 chain) [Cleaved into: Detyrosinated tubulin alpha-1A chain]	EBI-20626314	0.35
B1AH87	Translocator protein (Peripheral-type benzodiazepine receptor)	EBI-20626314	0.35
Q9NS69	Mitochondrial import receptor subunit TOM22 homolog (hTom22) (1C9-2) (Translocase of outer membrane 22 kDa subunit homolog)	EBI-20626314	0.35
Q96JJ7	Protein disulfide-isomerase TMX3 (EC 5.3.4.1) (Thioredoxin domain-containing protein 10) (Thioredoxin-related transmembrane protein 3)	EBI-20626314	0.35
Q5BJD5	Transmembrane protein 41B (Protein stasimon)	EBI-20626314	0.50
Q9HC07	Transmembrane protein 165 (Transmembrane protein PT27) (Transmembrane protein TPARL)	EBI-20626314	0.35
Q9H061	Transmembrane protein 126A	EBI-20626314	0.35
Q9HD45	Transmembrane 9 superfamily member 3 (EP70-P-iso) (SM-11044-binding protein)	EBI-20626314	0.35
Q99805	Transmembrane 9 superfamily member 2 (p76)	EBI-20626314	0.35
Q9NPL8	Complex I assembly factor TIMMDC1, mitochondrial (Protein M5-14) (Translocase of inner mitochondrial membrane domain-containing protein 1) (TIMM domain containing-protein 1)	EBI-20626314	0.35
Q3ZCQ8	Mitochondrial import inner membrane translocase subunit TIM50	EBI-20626314	0.35
O60830	Mitochondrial import inner membrane translocase subunit Tim17-B	EBI-20626314	0.35
Q7L0J3	Synaptic vesicle glycoprotein 2A	EBI-20626314	0.35
Q9UJZ1	Stomatin-like protein 2, mitochondrial (SLP-2) (EPB72-like protein 2) (Paraprotein target 7) (Paratarg-7)	EBI-20626314	0.35
Q01650	Large neutral amino acids transporter small subunit 1 (4F2 light chain) (4F2 LC) (4F2LC) (CD98 light chain) (Integral membrane protein E16) (E16) (L-type amino acid transporter 1) (hLAT1) (Solute carrier family 7 member 5) (y+ system cationic amino acid transporter)	EBI-20626314	0.35
P08195	4F2 cell-surface antigen heavy chain (4F2hc) (4F2 heavy chain antigen) (Lymphocyte activation antigen 4F2 large subunit) (Solute carrier family 3 member 2) (CD antigen CD98)	EBI-20626314	0.35
C4N9M8	Zinc transporter ZIP9 (ZIP-9) (Solute carrier family 39 member 9) (Zrt- and Irt-like protein 9)	EBI-20626314	0.35
Q9H2H9	Sodium-coupled neutral amino acid symporter 1 (Amino acid transporter A1) (N-system amino acid transporter 2) (Solute carrier family 38 member 1) (System A amino acid transporter 1) (System N amino acid transporter 1)	EBI-20626314	0.35
P11166	Solute carrier family 2, facilitated glucose transporter member 1 (Glucose transporter type 1, erythrocyte/brain) (GLUT-1) (HepG2 glucose transporter)	EBI-20626314	0.35
P12236	ADP/ATP translocase 3 (ADP,ATP carrier protein 3) (ADP,ATP carrier protein, isoform T2) (ANT 2) (Adenine nucleotide translocator 3) (ANT 3) (Solute carrier family 25 member 6) [Cleaved into: ADP/ATP translocase 3, N-terminally processed]	EBI-20626314	0.35
Q00325	Phosphate carrier protein, mitochondrial (Phosphate transport protein) (PTP) (Solute carrier family 25 member 3)	EBI-20626314	0.35
Q9H936	Mitochondrial glutamate carrier 1 (GC-1) (Glutamate/H(+) symporter 1) (Solute carrier family 25 member 22)	EBI-20626314	0.35
Q9UJS0	Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial (Calcium-binding mitochondrial carrier protein Aralar2) (ARALAR-related gene 2) (ARALAR2) (Citrin) (Mitochondrial aspartate glutamate carrier 2) (Solute carrier family 25 member 13)	EBI-20626314	0.35
O75746	Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial (Araceli hiperlarga) (Aralar) (Aralar1) (Mitochondrial aspartate glutamate carrier 1) (Solute carrier family 25 member 12)	EBI-20626314	0.35
Q15758	Neutral amino acid transporter B(0) (ATB(0)) (Baboon M7 virus receptor) (RD114/simian type D retrovirus receptor) (Sodium-dependent neutral amino acid transporter type 2) (Solute carrier family 1 member 5)	EBI-20626314	0.35
P53985	Monocarboxylate transporter 1 (MCT 1) (Solute carrier family 16 member 1)	EBI-20626314	0.35
Q96EP9	Sodium/bile acid cotransporter 4 (Na(+)/bile acid cotransporter 4) (Solute carrier family 10 member 4)	EBI-20626314	0.35
Q9BWM7	Sideroflexin-3	EBI-20626314	0.35
P61619	Protein transport protein Sec61 subunit alpha isoform 1 (Sec61 alpha-1)	EBI-20626314	0.35
Q86SK9	Stearoyl-CoA desaturase 5 (EC 1.14.19.1) (Acyl-CoA-desaturase 4) (HSCD5) (Stearoyl-CoA 9-desaturase) (Stearoyl-CoA desaturase 2)	EBI-20626314	0.35
Q8TAC9	Secretory carrier-associated membrane protein 5 (Secretory carrier membrane protein 5) (hSCAMP5)	EBI-20626314	0.35
O14828	Secretory carrier-associated membrane protein 3 (Secretory carrier membrane protein 3)	EBI-20626314	0.35
O75845	Lathosterol oxidase (EC 1.14.19.20) (C-5 sterol desaturase) (Delta(7)-sterol 5-desaturase) (Delta(7)-sterol C5(6)-desaturase) (Lathosterol 5-desaturase) (Sterol-C5-desaturase)	EBI-20626314	0.35
Q9NTJ5	Phosphatidylinositol-3-phosphatase SAC1 (EC 3.1.3.64) (Phosphatidylinositol-4-phosphate phosphatase) (Suppressor of actin mutations 1-like protein)	EBI-20626314	0.35
Q96ER3	Protein SAAL1 (Synoviocyte proliferation-associated in collagen-induced arthritis protein 1) (SPACIA1)	EBI-20626314	0.35
P04844	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit) (RIBIIR) (Ribophorin II) (RPN-II) (Ribophorin-2)	EBI-20626314	0.35
O43251	RNA binding protein fox-1 homolog 2 (Fox-1 homolog B) (Hexaribonucleotide-binding protein 2) (RNA-binding motif protein 9) (RNA-binding protein 9) (Repressor of tamoxifen transcriptional activity)	EBI-20626314	0.50
Q14964	Ras-related protein Rab-39A (Rab-39)	EBI-20626314	0.35
Q9NP72	Ras-related protein Rab-18	EBI-20626314	0.35
O60831	PRA1 family protein 2	EBI-20626314	0.35
O00264	Membrane-associated progesterone receptor component 1 (mPR) (Dap1) (IZA)	EBI-20626314	0.35
Q15070	Mitochondrial inner membrane protein OXA1L (Hsa) (OXA1Hs) (Oxidase assembly 1-like protein) (OXA1-like protein)	EBI-20626314	0.35
P01111	GTPase NRas (EC 3.6.5.2) (Transforming protein N-Ras)	EBI-20626314	0.35
O75352	Mannose-P-dolichol utilization defect 1 protein (Suppressor of Lec15 and Lec35 glycosylation mutation homolog) (SL15)	EBI-20626314	0.35
Q13015	Protein AF1q	EBI-20626314	0.35
O95490	Adhesion G protein-coupled receptor L2 (Calcium-independent alpha-latrotoxin receptor 2) (CIRL-2) (Latrophilin homolog 1) (Latrophilin-2) (Lectomedin-1)	EBI-20626314	0.35
Q8NF37	Lysophosphatidylcholine acyltransferase 1 (LPC acyltransferase 1) (LPCAT-1) (LysoPC acyltransferase 1) (EC 2.3.1.23) (1-acylglycerol-3-phosphate O-acyltransferase) (EC 2.3.1.51) (1-acylglycerophosphocholine O-acyltransferase) (1-alkenylglycerophosphocholine O-acyltransferase) (EC 2.3.1.25) (1-alkylglycerophosphocholine O-acetyltransferase) (EC 2.3.1.67) (Acetyl-CoA:lyso-platelet-activating factor acetyltransferase) (Acetyl-CoA:lyso-PAF acetyltransferase) (Lyso-PAF acetyltransferase) (LysoPAFAT) (Acyltransferase-like 2) (Phosphonoformate immuno-associated protein 3)	EBI-20626314	0.35
Q8N6L1	Keratinocyte-associated protein 2 (KCP-2) (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2) (Oligosaccharyl transferase subunit KCP2)	EBI-20626314	0.35
Q8TEX9	Importin-4 (Imp4) (Importin-4b) (Imp4b) (Ran-binding protein 4) (RanBP4)	EBI-20626314	0.35
Q16891	MICOS complex subunit MIC60 (Cell proliferation-inducing gene 4/52 protein) (Mitochondrial inner membrane protein) (Mitofilin) (p87/89)	EBI-20626314	0.35
Q53GQ0	Very-long-chain 3-oxoacyl-CoA reductase (EC 1.1.1.330) (17-beta-hydroxysteroid dehydrogenase 12) (17-beta-HSD 12) (3-ketoacyl-CoA reductase) (KAR) (Estradiol 17-beta-dehydrogenase 12) (EC 1.1.1.62) (Short chain dehydrogenase/reductase family 12C member 1)	EBI-20626314	0.35
Q8TCT9	Minor histocompatibility antigen H13 (EC 3.4.23.-) (Intramembrane protease 1) (IMP-1) (IMPAS-1) (hIMP1) (Presenilin-like protein 3) (Signal peptide peptidase)	EBI-20626314	0.35
P04439	HLA class I histocompatibility antigen, A alpha chain (Human leukocyte antigen A) (HLA-A)	EBI-20626314	0.35
O75367	Core histone macro-H2A.1 (Histone macroH2A1) (mH2A1) (Histone H2A.y) (H2A/y) (Medulloblastoma antigen MU-MB-50.205)	EBI-20626314	0.35
P08754	Guanine nucleotide-binding protein G(i) subunit alpha-3 (G(i) alpha-3)	EBI-20626314	0.35
Q9H0Q3	FXYD domain-containing ion transport regulator 6 (Phosphohippolin)	EBI-20626314	0.35
Q86VR2	Reticulophagy regulator 3	EBI-20626314	0.35
Q9BW60	Elongation of very long chain fatty acids protein 1 (EC 2.3.1.199) (3-keto acyl-CoA synthase ELOVL1) (ELOVL fatty acid elongase 1) (ELOVL FA elongase 1) (Very long chain 3-ketoacyl-CoA synthase 1) (Very long chain 3-oxoacyl-CoA synthase 1)	EBI-20626314	0.35
O75165	DnaJ homolog subfamily C member 13 (Required for receptor-mediated endocytosis 8) (RME-8)	EBI-20626314	0.35
Q9UBM7	7-dehydrocholesterol reductase (7-DHC reductase) (EC 1.3.1.21) (Delta7-sterol reductase) (Sterol Delta(7)-reductase) (Sterol reductase SR-2)	EBI-20626314	0.35
Q15392	Delta(24)-sterol reductase (EC 1.3.1.72) (24-dehydrocholesterol reductase) (3-beta-hydroxysterol Delta-24-reductase) (Diminuto/dwarf1 homolog) (Seladin-1)	EBI-20626314	0.35
P39656	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit (DDOST 48 kDa subunit) (Oligosaccharyl transferase 48 kDa subunit)	EBI-20626314	0.35
Q7KZN9	Cytochrome c oxidase assembly protein COX15 homolog	EBI-20626314	0.35
Q9UBF2	Coatomer subunit gamma-2 (Gamma-2-coat protein) (Gamma-2-COP)	EBI-20626314	0.35
Q9NX63	MICOS complex subunit MIC19 (Coiled-coil-helix-coiled-coil-helix domain-containing protein 3)	EBI-20626314	0.35
Q8N111	Cell cycle exit and neuronal differentiation protein 1 (BM88 antigen)	EBI-20626314	0.50
O95674	Phosphatidate cytidylyltransferase 2 (EC 2.7.7.41) (CDP-DAG synthase 2) (CDP-DG synthase 2) (CDP-diacylglycerol synthase 2) (CDS 2) (CDP-diglyceride pyrophosphorylase 2) (CDP-diglyceride synthase 2) (CTP:phosphatidate cytidylyltransferase 2)	EBI-20626314	0.35
O14735	CDP-diacylglycerol--inositol 3-phosphatidyltransferase (EC 2.7.8.11) (Phosphatidylinositol synthase) (PI synthase) (PtdIns synthase)	EBI-20626314	0.35
Q96A33	PAT complex subunit CCDC47 (Calumin) (Coiled-coil domain-containing protein 47)	EBI-20626314	0.35
P35613	Basigin (5F7) (Collagenase stimulatory factor) (Extracellular matrix metalloproteinase inducer) (EMMPRIN) (Hepatoma-associated antigen) (HAb18G) (Leukocyte activation antigen M6) (OK blood group antigen) (Tumor cell-derived collagenase stimulatory factor) (TCSF) (CD antigen CD147)	EBI-20626314	0.35
Q9Y679	Lipid droplet-regulating VLDL assembly factor AUP1 (Ancient ubiquitous protein 1)	EBI-20626314	0.35
Q01814	Plasma membrane calcium-transporting ATPase 2 (PMCA2) (EC 7.2.2.10) (Plasma membrane calcium ATPase isoform 2) (Plasma membrane calcium pump isoform 2)	EBI-20626314	0.35
O14983	Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (SERCA1) (SR Ca(2+)-ATPase 1) (EC 7.2.2.10) (Calcium pump 1) (Calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle isoform) (Endoplasmic reticulum class 1/2 Ca(2+) ATPase)	EBI-20626314	0.35
P05026	Sodium/potassium-transporting ATPase subunit beta-1 (Sodium/potassium-dependent ATPase subunit beta-1)	EBI-20626314	0.35
P13637	Sodium/potassium-transporting ATPase subunit alpha-3 (Na(+)/K(+) ATPase alpha-3 subunit) (EC 7.2.2.13) (Na(+)/K(+) ATPase alpha(III) subunit) (Sodium pump subunit alpha-3)	EBI-20626314	0.35
P05023	Sodium/potassium-transporting ATPase subunit alpha-1 (Na(+)/K(+) ATPase alpha-1 subunit) (EC 7.2.2.13) (Sodium pump subunit alpha-1)	EBI-20626314	0.35
Q9BVK2	Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase (EC 2.4.1.265) (Asparagine-linked glycosylation protein 8 homolog) (Dol-P-Glc:Glc(1)Man(9)GlcNAc(2)-PP-dolichyl alpha-1,3-glucosyltransferase) (Dolichyl-P-Glc:Glc1Man9GlcNAc2-PP-dolichyl glucosyltransferase)	EBI-20626314	0.35
Q9NP58	ATP-binding cassette sub-family B member 6 (ABC-type heme transporter ABCB6) (EC 7.6.2.5) (Mitochondrial ABC transporter 3) (Mt-ABC transporter 3) (P-glycoprotein-related protein) (Ubiquitously-expressed mammalian ABC half transporter)	EBI-20626314	0.35
Q9Y312	Protein AAR2 homolog (AAR2 splicing factor homolog)	EBI-20626314	0.35
Q99653	Calcineurin B homologous protein 1 (Calcineurin B-like protein) (Calcium-binding protein CHP) (Calcium-binding protein p22) (EF-hand calcium-binding domain-containing protein p22)	EBI-20639074	0.50

Cross-References

Database	Links
UNIPROT	A0A142I5B9 H9A910
PDB	6UTA 7BPK 7BQ5
Pfam	PF01003 PF07652 PF02832 PF00869 PF01004 PF00948 PF01005 PF01002 PF01350 PF01349 PF00972 PF01570 PF01728 PF00949
PROSITE	PS51527 PS51528 PS51192 PS51194 PS50507 PS51591

RNA-directed RNA polymerase NS5 (Zika virus ZIKV/Human/Cambodia/FSS13025/2010)

General Information

Protein Information

Structure Viewer (PDB: 6UTA)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (28 interactors)

Interactions with other proteins (357 interactors)

Cross-References

Database

Links

Description

Description