Nuclear pore complex protein Nup153 - Homo sapiens

Nuclear pore complex protein Nup153 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Nuclear pore complex protein Nup153
Accession Code	P49790
Gene	NUP153
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 1475)
MASGAGGVGGGGGGKIRTRRCHQGPIKPYQQGRQQHQGILSRVTESVKNIVPGWLQRYFNKNEDVCSCSTDTSEVPRWPE NKEDHLVYADEESSNITDGRITPEPAVSNTEEPSTTSTASNYPDVLTRPSLHRSHLNFSMLESPALHCQPSTSSAFPIGS SGFSLVKEIKDSTSQHDDDNISTTSGFSSRASDKDITVSKNTSLPPLWSPEAERSHSLSQHTATSSKKPAFNLSAFGTLS PSLGNSSILKTSQLGDSPFYPGKTTYGGAAAAVRQSKLRNTPYQAPVRRQMKAKQLSAQSYGVTSSTARRILQSLEKMSS PLADAKRIPSIVSSPLNSPLDRSGIDITDFQAKREKVDSQYPPVQRLMTPKPVSIATNRSVYFKPSLTPSGEFRKTNQRI DNKCSTGYEKNMTPGQNREQRESGFSYPNFSLPAANGLSSGVGGGGGKMRRERTRFVASKPLEEEEMEVPVLPKISLPIT SSSLPTFNFSSPEITTSSPSPINSSQALTNKVQMTSPSSTGSPMFKFSSPIVKSTEANVLPPSSIGFTFSVPVAKTAELS GSSSTLEPIISSSAHHVTTVNSTNCKKTPPEDCEGPFRPAEILKEGSVLDILKSPGFASPKIDSVAAQPTATSPVVYTRP AISSFSSSGIGFGESLKAGSSWQCDTCLLQNKVTDNKCIACQAAKLSPRDTAKQTGIETPNKSGKTTLSASGTGFGDKFK PVIGTWDCDTCLVQNKPEAIKCVACETPKPGTCVKRALTLTVVSESAETMTASSSSCTVTTGTLGFGDKFKRPIGSWECS VCCVSNNAEDNKCVSCMSEKPGSSVPASSSSTVPVSLPSGGSLGLEKFKKPEGSWDCELCLVQNKADSTKCLACESAKPG TKSGFKGFDTSSSSSNSAASSSFKFGVSSSSSGPSQTLTSTGNFKFGDQGGFKIGVSSDSGSINPMSEGFKFSKPIGDFK FGVSSESKPEEVKKDSKNDNFKFGLSSGLSNPVSLTPFQFGVSNLGQEEKKEELPKSSSAGFSFGTGVINSTPAPANTIV TSENKSSFNLGTIETKSASVAPFTCKTSEAKKEEMPATKGGFSFGNVEPASLPSASVFVLGRTEEKQQEPVTSTSLVFGK KADNEEPKCQPVFSFGNSEQTKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQTSTTADQGAAKPVFSFLNNSSSSS STPATSAGGGIFGSSTSSSNPPVATFVFGQSSNPVSSSAFGNTAESSTSQSLLFSQDSKLATTSSTGTAVTPFVFGPGAS SNNTTTSGFGFGATTTSSSAGSSFVFGTGPSAPSASPAFGANQTPTFGQSQGASQPNPPGFGSISSSTALFPTGSQPAPP TFGTVSSSSQPPVFGQQPSQSAFGSGTTPNSSSAFQFGSSTTNFNFTNNSPSGVFTFGANSSTPAASAQPSGSGGFPFNQ SPAAFTVGSNGKNVFSSSGTSFSGRKIKTAVRRRK

Structure Viewer (PDB: 4U0C)

Subcellular Location

Description
Nucleus. Nucleus membrane. Nucleus, nuclear pore complex. Note=Tightly associated with the nuclear membrane and lamina (By similarity). Localized to the nucleoplasmic side of the nuclear pore complex (NPC) core structure, forming a fibrous structure called the nuclear basket. Dissociates from the NPC structure early during prophase of mitosis. Integrated in the newly assembled nuclear envelope of postmitotic cells early in G1. Colocalized with NUP98 and TPR to the nuclear basket at the nucleoplasmic side of the NPC. Detected in diffuse and discrete intranuclear foci. Remained localized to the nuclear membrane after poliovirus (PV) infection. {By Similarity}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Nuclear Pore Complex	SL-0185	The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active bidirectional transport of macromolecules such as proteins, RNAs etc across the double-membrane nuclear envelope.The NPC is composed of at least 30 distinct subunits known as Nucleoporins (NUPs).
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytosol (GO:0005829) Host Cell (GO:0043657) Membrane (GO:0016020) Nuclear Envelope (GO:0005635) Nuclear Inclusion Body (GO:0042405) Nuclear Membrane (GO:0031965) Nuclear Periphery (GO:0034399) Nuclear Pore (GO:0005643) Nuclear Pore Nuclear Basket (GO:0044615) Nucleolus (GO:0005730) Nucleoplasm (GO:0005654)

Biology & Function

Description
Component of the nuclear pore complex (NPC), a complex required for the trafficking across the nuclear envelope. Functions as a scaffolding element in the nuclear phase of the NPC essential for normal nucleocytoplasmic transport of proteins and mRNAs. Involved in the quality control and retention of unspliced mRNAs in the nucleus; in association with TPR, regulates the nuclear export of unspliced mRNA species bearing constitutive transport element (CTE) in a NXF1- and KHDRBS1-independent manner. Mediates TPR anchoring to the nuclear membrane at NPC. The repeat-containing domain may be involved in anchoring other components of the NPC to the pore membrane. Possible DNA-binding subunit of the nuclear pore complex (NPC). {Experimental EvidencePubMed:12802065, Experimental EvidencePubMed:15229283, Experimental EvidencePubMed:22253824}. (Microbial infection) Interacts with HIV-1 caspid protein P24 and thereby promotes the integration of the virus in the nucleus of non-dividing cells (in vitro). {Experimental EvidencePubMed:23523133, Experimental EvidencePubMed:24130490, Experimental EvidencePubMed:29997211}. (Microbial infection) Binds HIV-2 protein vpx and thereby promotes the nuclear translocation of the lentiviral genome (in vitro). {Experimental EvidencePubMed:24130490, ECO:0000269\|PubMed:31913756}.
Assigned Ontology terms

Biological Process	MRNA Transport (GO:0051028) Negative Regulation Of RNA Export From Nucleus (GO:0046832) Nuclear Pore Complex Assembly (GO:0051292) Nucleocytoplasmic Transport (GO:0006913) Protein Import Into Nucleus (GO:0006606) RNA Export From Nucleus (GO:0006405) Viral Entry Into Host Cell (GO:0046718) Viral Penetration Into Host Nucleus (GO:0075732)
Molecular Function	DNA Binding (GO:0003677) Identical Protein Binding (GO:0042802) Metal Ion Binding (GO:0046872) Nuclear Localization Sequence Binding (GO:0008139) Protein-Membrane Adaptor Activity (GO:0043495) Structural Constituent Of Nuclear Pore (GO:0017056)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (43 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
A8CG34	Nuclear envelope pore membrane protein POM 121C	EBI-11076796	0.35
O15504	Nucleoporin NUP42	EBI-11076796	0.35
P12270	Nucleoprotein TPR	EBI-11076796	0.35
P35658	Nuclear pore complex protein Nup214	EBI-11076796	0.35
P46060	Ran GTPase-activating protein 1	EBI-11076796	0.35
Q9UBU9	Nuclear RNA export factor 1	EBI-7193245	0.76
Q9Y2K6	Ubiquitin carboxyl-terminal hydrolase 20	EBI-2512022	0.40
P49790	Self	EBI-8232524	0.60
P62826	GTP-binding nuclear protein Ran	EBI-9688194	0.64
Q6PFD9	Nuclear pore complex protein Nup96	EBI-10994876	0.35
Q9ERU9	E3 SUMO-protein ligase RanBP2	EBI-10999306	0.35
Q80U93	Nuclear pore complex protein Nup214	EBI-11014856	0.35
Q8TEM1	Nuclear pore membrane glycoprotein 210	EBI-11076796	0.35
P78406	mRNA export factor RAE1	EBI-11076796	0.35
Q8NFH5	Nucleoporin NUP35	EBI-11076796	0.35
P52948	Nuclear pore complex protein Nup96	EBI-11076796	0.35
P63165	Small ubiquitin-related modifier 1	EBI-11076796	0.35
Q96HA1	Nuclear envelope pore membrane protein POM 121	EBI-11076796	0.35
Q9UKX7	Nuclear pore complex protein Nup50	EBI-11076796	0.35
P63279	SUMO-conjugating enzyme UBC9	EBI-11076796	0.35
Q9BW27	Nuclear pore complex protein Nup85	EBI-11076796	0.35
Q8NFH4	Nucleoporin Nup37	EBI-11076796	0.35
P49792	E3 SUMO-protein ligase RanBP2	EBI-11076796	0.35
Q8NFH3	Nucleoporin Nup43	EBI-11076796	0.35
Q99567	Nuclear pore complex protein Nup88	EBI-11076796	0.35
Q8N1F7	Nuclear pore complex protein Nup93	EBI-11076796	0.35
Q9HC62	Sentrin-specific protease 2	EBI-11076796	0.35
Q96EE3	Nucleoporin SEH1	EBI-11076796	0.35
Q92621	Nuclear pore complex protein Nup205	EBI-11076796	0.35
Q5SRE5	Nucleoporin NUP188	EBI-11076796	0.35
Q12769	Nuclear pore complex protein Nup160	EBI-11076796	0.35
Q9NRG9	Aladin	EBI-11076796	0.35
Q13625	Apoptosis-stimulating of p53 protein 2	EBI-9688225	0.35
Q9UPY3	Endoribonuclease Dicer	EBI-20621330	0.50
Q53GS7	mRNA export factor GLE1	EBI-11076796	0.35
Q14974	Importin subunit beta-1	EBI-11076796	0.77
P70168	Importin subunit beta-1	EBI-15732587	0.52
P02545	Lamin-A/C	EBI-8034338	0.45
Q9BTX1	Nucleoporin NDC1	EBI-11076796	0.35
Q9NXE4	Sphingomyelin phosphodiesterase 4	EBI-11076796	0.35
P57740	Nuclear pore complex protein Nup107	EBI-11076796	0.35
Q8BH74	Nuclear pore complex protein Nup107	EBI-10997196	0.35
Q8WUM0	Nuclear pore complex protein Nup133	EBI-7329388	0.53
Interactions with other proteins (73 interactors)

Partner (UniProt)		IntAct	Confidence score
P29323	Ephrin type-B receptor 2 (EC 2.7.10.1) (Developmentally-regulated Eph-related tyrosine kinase) (ELK-related tyrosine kinase) (EPH tyrosine kinase 3) (EPH-like kinase 5) (EK5) (hEK5) (Renal carcinoma antigen NY-REN-47) (Tyrosine-protein kinase TYRO5) (Tyrosine-protein kinase receptor EPH-3) [Cleaved into: EphB2/CTF1; EphB2/CTF2]	EBI-7234474	0.54
Q16539	Mitogen-activated protein kinase 14 (MAP kinase 14) (MAPK 14) (EC 2.7.11.24) (Cytokine suppressive anti-inflammatory drug-binding protein) (CSAID-binding protein) (CSBP) (MAP kinase MXI2) (MAX-interacting protein 2) (Mitogen-activated protein kinase p38 alpha) (MAP kinase p38 alpha) (Stress-activated protein kinase 2a) (SAPK2a)	EBI-7234526	0.54
P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	EBI-1237540	0.35
Q8IY92	Structure-specific endonuclease subunit SLX4 (BTB/POZ domain-containing protein 12)	EBI-2371263	0.35
P51784	Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.4.19.12) (Deubiquitinating enzyme 11) (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11)	EBI-2511298	0.40
Q9QWT9	Kinesin-like protein KIFC1	EBI-2558911	0.40
E9PVX6	Proliferation marker protein Ki-67 (Antigen identified by monoclonal antibody Ki-67 homolog) (Antigen KI-67 homolog) (Antigen Ki67 homolog)	EBI-2561030	0.40
A0A6L7HHZ0	Beta-lactam antibiotic acylase family protein	EBI-2815987	0.00
A0A6L8PGJ0	Cysteine synthase (EC 2.5.1.47)	EBI-2816005	0.00
Q9ZC54	ABC transporter permease (Putative membrane protein) (Similar to ABC transporter: eg YBJZ_ECOLI hypothetical ABC transporter)	EBI-2846253	0.00
P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	EBI-2878124	0.35
Q13573	SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein)	EBI-7950968	0.35
P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	EBI-3437314	0.00
Q05322	Membrane-associated protein VP24 (Ebola VP24) (eVP24)	EBI-6159823	0.35
Q13618	Cullin-3 (CUL-3)	EBI-21329068	0.35
Q5S007	Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin)	EBI-6515052	0.35
Q96DB2	Histone deacetylase 11 (HD11) (EC 3.5.1.98)	EBI-6598272	0.35
Q8WUF5	RelA-associated inhibitor (Inhibitor of ASPP protein) (Protein iASPP) (NFkB-interacting protein 1) (PPP1R13B-like protein)	EBI-9688209	0.35
P03367	Gag-Pol polyprotein (Pr160Gag-Pol) [Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-)]	EBI-9872771	0.40
O14862	Interferon-inducible protein AIM2 (Absent in melanoma 2)	EBI-9995694	0.35
P06428	Protein E6	EBI-11722493	0.35
E9PUA5	Kinesin-like protein	EBI-10999661	0.35
Q8VE37	Regulator of chromosome condensation (Chromosome condensation protein 1)	EBI-11043815	0.35
P63280	SUMO-conjugating enzyme UBC9 (EC 2.3.2.-) (RING-type E3 SUMO transferase UBC9) (SUMO-protein ligase) (Ubiquitin carrier protein 9) (mUBC9) (Ubiquitin carrier protein I) (Ubiquitin-conjugating enzyme E2 I) (Ubiquitin-protein ligase I)	EBI-11044140	0.35
P18754	Regulator of chromosome condensation (Cell cycle regulatory protein) (Chromosome condensation protein 1)	EBI-11076796	0.35
Q92973	Transportin-1 (Importin beta-2) (Karyopherin beta-2) (M9 region interaction protein) (MIP)	EBI-11076796	0.53
O00629	Importin subunit alpha-3 (Importin alpha Q1) (Qip1) (Karyopherin subunit alpha-4)	EBI-11076796	0.35
Q9H9A5	CCR4-NOT transcription complex subunit 10	EBI-11076796	0.35
Q8IXQ5	Kelch-like protein 7	EBI-11076796	0.35
J3KMX2	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2	EBI-11076796	0.35
P52292	Importin subunit alpha-1 (Karyopherin subunit alpha-2) (RAG cohort protein 1) (SRP1-alpha)	EBI-11076796	0.53
Q69YH5	Cell division cycle-associated protein 2 (Recruits PP1 onto mitotic chromatin at anaphase protein) (Repo-Man)	EBI-11076796	0.35
P61956	Small ubiquitin-related modifier 2 (SUMO-2) (HSMT3) (SMT3 homolog 2) (SUMO-3) (Sentrin-2) (Ubiquitin-like protein SMT3B) (Smt3B)	EBI-11076796	0.35
P33991	DNA replication licensing factor MCM4 (EC 3.6.4.12) (CDC21 homolog) (P1-CDC21)	EBI-11076796	0.35
P62136	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16)	EBI-11076796	0.53
O14715	RANBP2-like and GRIP domain-containing protein 8 (Ran-binding protein 2-like 3) (RanBP2-like 3) (RanBP2L3)	EBI-11076796	0.35
O00505	Importin subunit alpha-4 (Importin alpha Q2) (Qip2) (Karyopherin subunit alpha-3) (SRP1-gamma)	EBI-11076796	0.35
Q03188	Centromere protein C (CENP-C) (Centromere autoantigen C) (Centromere protein C 1) (CENP-C 1) (Interphase centromere complex protein 7)	EBI-11076796	0.35
Q969G3	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 (BRG1-associated factor 57) (BAF57)	EBI-11076796	0.35
O60684	Importin subunit alpha-7 (Karyopherin subunit alpha-6)	EBI-11076796	0.35
O95373	Importin-7 (Imp7) (Ran-binding protein 7) (RanBP7)	EBI-11076796	0.35
Q86XI6	Protein phosphatase 1 regulatory subunit 3B (Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL) (Protein phosphatase 1 regulatory subunit 4) (PP1 subunit R4) (Protein phosphatase 1 subunit GL) (PTG)	EBI-11076796	0.35
Q96SK2	Transmembrane protein 209	EBI-11076796	0.35
P52294	Importin subunit alpha-5 (Karyopherin subunit alpha-1) (Nucleoprotein interactor 1) (NPI-1) (RAG cohort protein 2) (SRP1-beta) [Cleaved into: Importin subunit alpha-5, N-terminally processed]	EBI-11076796	0.35
Q8TAQ2	SWI/SNF complex subunit SMARCC2 (BRG1-associated factor 170) (BAF170) (SWI/SNF complex 170 kDa subunit) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 2)	EBI-11076796	0.35
Q9P0U3	Sentrin-specific protease 1 (EC 3.4.22.-) (Sentrin/SUMO-specific protease SENP1)	EBI-11076796	0.35
Q9BW19	Kinesin-like protein KIFC1 (Kinesin-like protein 2) (Kinesin-related protein HSET)	EBI-11076796	0.35
E9PF10	Nuclear pore complex protein Nup155	EBI-11076796	0.35
Q6NUQ4	Transmembrane protein 214	EBI-11076796	0.35
Q9BPU9	B9 domain-containing protein 2 (MKS1-related protein 2)	EBI-11377507	0.27
Q9GZY0	Nuclear RNA export factor 2 (Cancer/testis antigen 39) (CT39) (TAP-like protein 2) (TAPL-2)	EBI-21528397	0.35
P36873	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PP-1G) (EC 3.1.3.16) (Protein phosphatase 1C catalytic subunit)	EBI-21564320	0.35
Q9BXS6	Nucleolar and spindle-associated protein 1 (NuSAP)	EBI-21691494	0.35
Q8N9Q2	Protein SREK1IP1 (SFRS12-interacting protein 1) (SREK1-interacting protein 1) (Splicing regulatory protein of 18 kDa) (p18SRP)	EBI-21723640	0.35
Q2NL82	Pre-rRNA-processing protein TSR1 homolog	EBI-21815364	0.35
Q9UN86	Ras GTPase-activating protein-binding protein 2 (G3BP-2) (GAP SH3 domain-binding protein 2)	EBI-21866171	0.35
P35408	Prostaglandin E2 receptor EP4 subtype (PGE receptor EP4 subtype) (PGE2 receptor EP4 subtype) (Prostanoid EP4 receptor)	EBI-20811254	0.37
O96013	Serine/threonine-protein kinase PAK 4 (EC 2.7.11.1) (p21-activated kinase 4) (PAK-4)	EBI-26962273	0.35
Q8WVM7	Cohesin subunit SA-1 (SCC3 homolog 1) (Stromal antigen 1)	EBI-24811291	0.35
Q8N3U4	Cohesin subunit SA-2 (SCC3 homolog 2) (Stromal antigen 2)	EBI-24811308	0.35
Q8WUY9	DEP domain-containing protein 1B (HBV X-transactivated gene 8 protein) (HBV XAg-transactivated protein 8)	EBI-25411615	0.35
A0A0H3LH51	PE family-related protein	EBI-25401350	0.35
Q7RTV0	PHD finger-like domain-containing protein 5A (PHD finger-like domain protein 5A) (Splicing factor 3B-associated 14 kDa protein) (SF3b14b)	EBI-25482472	0.35
P83105	Serine protease HTRA4 (EC 3.4.21.-) (High-temperature requirement factor A4)	EBI-25745135	0.35
Q09161	Nuclear cap-binding protein subunit 1 (80 kDa nuclear cap-binding protein) (CBP80) (NCBP 80 kDa subunit)	EBI-26396507	0.35
P52298	Nuclear cap-binding protein subunit 2 (20 kDa nuclear cap-binding protein) (Cell proliferation-inducing gene 55 protein) (NCBP 20 kDa subunit) (CBP20) (NCBP-interacting protein 1) (NIP1)	EBI-26397631	0.35
K9N643	Non-structural protein ORF4b (ORF4b)	EBI-26375164	0.35
Q16566	Calcium/calmodulin-dependent protein kinase type IV (CaMK IV) (EC 2.7.11.17) (CaM kinase-GR)	EBI-28941485	0.35
Q05D32	CTD small phosphatase-like protein 2 (CTDSP-like 2) (EC 3.1.3.-)	EBI-27113232	0.35
O15297	Protein phosphatase 1D (EC 3.1.3.16) (Protein phosphatase 2C isoform delta) (PP2C-delta) (Protein phosphatase magnesium-dependent 1 delta) (p53-induced protein phosphatase 1)	EBI-27113880	0.35
Q9H9E1	Ankyrin repeat family A protein 2 (RFXANK-like protein 2)	EBI-30814700	0.44
Q93009	Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.4.19.12) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7)	EBI-30841851	0.44
P23771	Trans-acting T-cell-specific transcription factor GATA-3 (GATA-binding factor 3)	EBI-34580747	0.35

Cross-References

Database	Links
UNIPROT	P49790 B4DIK2 E7EPX5 F6QR24 Q4LE47 Q5T9I7 Q7Z743
PDB	2EBQ 2EBR 2EBV 2GQE 4U0C 4U0D 5TSV 5TSX 6AYA
Pfam	PF08604 PF10599 PF00641
PROSITE	PS01358 PS50199
OMIM	603948
DisGeNET	9972

Nuclear pore complex protein Nup153 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 4U0C)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (43 interactors)

Interactions with other proteins (73 interactors)

Cross-References

Database

Links

Description

Description