Protein Information |
|
---|---|
Protein Name | 2'-O-methyltransferase nsp16 |
Accession Code | P0DTD1 |
Gene | rep |
Organism | Severe acute respiratory syndrome coronavirus 2 (Taxonomy: 2697049) |
Part of Reference Proteome? | Yes |
Sequence (Length: 7096) | |
MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAP HGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQEN WNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRIRSVYPVASPNECNQMCLSTL MKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKG GRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVR VLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVE FLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEKYC ALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVI KTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPL EFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYI KNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGP NVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVE QKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLK KDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSII SNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLND LNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGSYKDWSYSGQS TQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLD GADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATAL LTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQT TLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHIT SKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPY PNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNK ATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPA NNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRC LNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCL GSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTA FGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRP INPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVY YSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQG FVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMS LSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHT DFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGD FLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGS IIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGA LDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDV SFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLP LTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCM VQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPK TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQT GIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQW SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLDMVDTSLSGFKLK DCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVF MCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKL NIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLS MQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRK LEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTY KNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQ TACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRG MVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES FGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFL NRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYN LLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVEN PDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLT RALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGP LVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQ TVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCI NANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTN RQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSL SHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLY ECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKG PHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYI RKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQAVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVIS TSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTN AGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIG EYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQK YSTLQGPPGTGKSHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYV FCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDM FLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYN SQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEIPRRN VATLQAENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFIT REEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYK GLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDY VYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHM VVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPAN SIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCIT RCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQSLENVAFNVVNKGHFDGQQGEVPVSIIN NTVYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDYKRDAPAHISTIGVCSMTDIA KKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEGSVKGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQ LPETYFTQSRNLQEFKPRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESPFELEDF IPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVVSKVVKVTIDYTEISFMLWCKDGHVETFYPKLQSS QAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGT AVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLA LGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSY SLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN |
Structure Viewer (PDB: 5RU5) |
---|
Description |
||
---|---|---|
[Host translation inhibitor nsp1]: Host cytoplasm {Experimental EvidencePubMed:33060197}. [Non-structural protein 2]: Host cytoplasm {Experimental EvidencePubMed:33060197}. Host endosome {Experimental EvidencePubMed:33060197}. [Papain-like protease nsp3]: Host membrane {By SimilarityUniProtKB:P0C6X7, Experimental EvidencePubMed:32763915}; Multi-pass membrane protein {By SimilarityUniProtKB:P0C6X7, Experimental EvidencePubMed:32763915}. Host cytoplasm {By SimilarityUniProtKB:P0C6X7}. [Non-structural protein 4]: Host membrane {By SimilarityUniProtKB:P0C6X7}; Multi-pass membrane protein {By SimilarityUniProtKB:P0C6X7}. Host cytoplasm {By SimilarityUniProtKB:P0C6X7}. Note=Localizes in virally-induced cytoplasmic double-membrane vesicles. {By SimilarityUniProtKB:P0C6X7}. [3C-like proteinase nsp5]: Host cytoplasm {Experimental EvidencePubMed:33060197}. Host Golgi apparatus {Experimental EvidencePubMed:33060197}. [Non-structural protein 6]: Host membrane {By SimilarityUniProtKB:P0C6X7}; Multi-pass membrane protein {By SimilarityUniProtKB:P0C6X7}. [Non-structural protein 7]: Host cytoplasm, host perinuclear region {ECO:0000250|UniProtKB:P0C6X9}. Host cytoplasm {Experimental EvidencePubMed:33060197}. Host endoplasmic reticulum {Experimental EvidencePubMed:33060197}. Note=nsp7, nsp8, nsp9 and nsp10 are localized in cytoplasmic foci, largely perinuclear. Late in infection, they merge into confluent complexes. {ECO:0000250|UniProtKB:P0C6X9}. [Non-structural protein 8]: Host cytoplasm, host perinuclear region {ECO:0000250|UniProtKB:P0C6X9}. Host cytoplasm {Experimental EvidencePubMed:33060197, ECO:0000269|PubMed:33080218}. Host endoplasmic reticulum {Experimental EvidencePubMed:33060197}. Note=nsp7, nsp8, nsp9 and nsp10 are localized in cytoplasmic foci, largely perinuclear. Late in infection, they merge into confluent complexes. {ECO:0000250|UniProtKB:P0C6X9}. [Non-structural protein 9]: Host cytoplasm, host perinuclear region {ECO:0000250|UniProtKB:P0C6X9}. Host cytoplasm {Experimental EvidencePubMed:33060197, ECO:0000269|PubMed:33080218}. Host endoplasmic reticulum {Experimental EvidencePubMed:33060197}. Note=nsp7, nsp8, nsp9 and nsp10 are localized in cytoplasmic foci, largely perinuclear. Late in infection, they merge into confluent complexes. {ECO:0000250|UniProtKB:P0C6X9}. [Non-structural protein 10]: Host cytoplasm, host perinuclear region {ECO:0000250|UniProtKB:P0C6X9}. Host cytoplasm {Experimental EvidencePubMed:33060197}. Host endoplasmic reticulum {Experimental EvidencePubMed:33060197}. Note=nsp7, nsp8, nsp9 and nsp10 are localized in cytoplasmic foci, largely perinuclear. Late in infection, they merge into confluent complexes. {ECO:0000250|UniProtKB:P0C6X9}. [Proofreading exoribonuclease nsp14]: Host cytoplasm {Experimental EvidencePubMed:33060197}. Host endoplasmic reticulum {Experimental EvidencePubMed:33060197}. Host endoplasmic reticulum. [Helicase nsp13]: Host endoplasmic reticulum- Golgi intermediate compartment {By SimilarityUniProtKB:P0C6X7}. Note=The helicase interacts with the N protein in membranous complexes and colocalizes with sites of synthesis of new viral RNA. {ECO:0000250|UniProtKB:P0C6X9}. [Uridylate-specific endoribonuclease nsp15]: Host cytoplasm, host perinuclear region {ECO:0000250|UniProtKB:P0C6X9}. [2'-O-methyltransferase nsp16]: Host nucleus. Host cytoplasm {ECO:0000269|PubMed:33080218}. | Position in the Nuclear Envelope |
|
Location | Location ID | Description |
Host Perinuclear Region | SL-0382 | The host perinuclear region is the host cytoplasmic region just around the host nucleus. Note: This location is defined for viral proteins that appear in the perinuclear region of infected host cells | Membrane Topology |
Topology | Source | Annotation Type |
Transmembrane | UniProt | Sequence Analysis {ECO:0000255} | Assigned Ontology terms |
Cellular Component | Cytoplasmic Viral Factory (GO:0039714) Double Membrane Vesicle Viral Factory Outer Membrane (GO:0062243) Endopeptidase Complex (GO:1905369) Endoribonuclease Complex (GO:1902555) Exoribonuclease Complex (GO:1905354) Host Cell Cytoplasm (GO:0030430) Host Cell Endoplasmic Reticulum (GO:0044165) Host Cell Endoplasmic Reticulum-Golgi Intermediate Compartment (GO:0044172) Host Cell Endosome (GO:0044174) Host Cell Golgi Apparatus (GO:0044177) Host Cell Nucleus (GO:0042025) Host Cell Perinuclear Region Of Cytoplasm (GO:0044220) Obsolete Integral To Membrane Of Host Cell (GO:0044385) MRNA Cap Binding Complex (GO:0005845) MRNA Cap Methyltransferase Complex (GO:0031533) Viral RNA-Directed RNA Polymerase Complex (GO:0031381) |
Description |
|
---|---|
[Replicase polyprotein 1ab]: Multifunctional protein involved in the transcription and replication of viral RNAs. Contains the proteinases responsible for the cleavages of the polyprotein. {By SimilarityUniProtKB:P0C6X7}. [Host translation inhibitor nsp1]: Inhibits host translation by associating with the open head conformation of the 40S subunit (PubMed:33479166, PubMed:33080218, PubMed:32680882, PubMed:32908316). The C-terminus binds to and obstructs ribosomal mRNA entry tunnel (PubMed:33479166, PubMed:33080218, PubMed:32680882, PubMed:32908316). Thereby inhibits antiviral response triggered by innate immunity or interferons (PubMed:33080218, PubMed:32680882, PubMed:32979938). The nsp1-40S ribosome complex further induces an endonucleolytic cleavage near the 5'UTR of host mRNAs, targeting them for degradation (By similarity). Viral mRNAs less susceptible to nsp1-mediated inhibition of translation, because of their 5'-end leader sequence (PubMed:32908316, PubMed:33080218). {By SimilarityUniProtKB:P0C6X7, Experimental EvidencePubMed:32680882, Experimental EvidencePubMed:32908316, Experimental EvidencePubMed:32979938, Experimental EvidencePubMed:33080218, Experimental EvidencePubMed:33479166}. [Non-structural protein 2]: May play a role in the modulation of host cell survival signaling pathway by interacting with host PHB and PHB2. Indeed, these two proteins play a role in maintaining the functional integrity of the mitochondria and protecting cells from various stresses. {By SimilarityUniProtKB:P0C6X7}. [Papain-like protease nsp3]: Responsible for the cleavages located at the N-terminus of the replicase polyprotein. Participates together with nsp4 in the assembly of virally-induced cytoplasmic double-membrane vesicles necessary for viral replication (By similarity). Forms a molecular pore spanning the double membrane of the coronavirus replication organelle (PubMed:32763915). Antagonizes innate immune induction of type I interferon by blocking the phosphorylation, dimerization and subsequent nuclear translocation of host IRF3 (PubMed:32733001). Prevents also host NF-kappa-B signaling (By similarity). In addition, PL-PRO possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cellular substrates (PubMed:32726803). Cleaves preferentially ISG15 from antiviral protein IFIH1 (MDA5), but not DDX58 (RIG-I) (PubMed:33727702). Can play a role in host ADP-ribosylation by binding ADP-ribose (PubMed:32578982). {By SimilarityUniProtKB:P0C6X7, Experimental EvidencePubMed:32578982, Experimental EvidencePubMed:32726803, Experimental EvidencePubMed:32733001, Experimental EvidencePubMed:32763915, Experimental EvidencePubMed:33727702}. [Non-structural protein 4]: Participates in the assembly of virally-induced cytoplasmic double-membrane vesicles necessary for viral replication. {By SimilarityUniProtKB:P0C6X7}. [3C-like proteinase nsp5]: Cleaves the C-terminus of replicase polyprotein at 11 sites (PubMed:32321856). Recognizes substrates containing the core sequence [ILMVF]-Q-|-[SGACN] (PubMed:32198291, PubMed:32272481). Also able to bind an ADP-ribose- 1''-phosphate (ADRP) (By similarity) (PubMed:32198291, PubMed:32272481). {By SimilarityUniProtKB:P0C6X7, Experimental EvidencePubMed:32198291, Experimental EvidencePubMed:32272481, Experimental EvidencePubMed:32321856}. [Non-structural protein 6]: Plays a role in the initial induction of autophagosomes from host reticulum endoplasmic (By similarity). Later, limits the expansion of these phagosomes that are no longer able to deliver viral components to lysosomes (By similarity). Binds to host TBK1 without affecting TBK1 phosphorylation; the interaction with TBK1 decreases IRF3 phosphorylation, which leads to reduced IFN-beta production (PubMed:32979938). {By SimilarityUniProtKB:P0C6X7, Experimental EvidencePubMed:32979938}. [Non-structural protein 7]: Plays a role in viral RNA synthesis (PubMed:32358203, PubMed:32277040, PubMed:32438371, PubMed:32526208). Forms a hexadecamer with nsp8 (8 subunits of each) that may participate in viral replication by acting as a primase. Alternatively, may synthesize substantially longer products than oligonucleotide primers (By similarity). {By SimilarityUniProtKB:P0C6X7, Experimental EvidencePubMed:32277040, ECO:0000269|PubMed:32358203, ECO:0000269|PubMed:32438371, ECO:0000269|PubMed:32526208}. [Non-structural protein 8]: Plays a role in viral RNA synthesis (PubMed:32358203, PubMed:32277040, PubMed:32438371, PubMed:32526208). Forms a hexadecamer with nsp7 (8 subunits of each) that may participate in viral replication by acting as a primase. Alternatively, may synthesize substantially longer products than oligonucleotide primers (By similarity). Interacts with ribosome signal recognition particle RNA (SRP) (PubMed:33080218). Together with NSP9, suppress protein integration into the cell membrane, thereby disrupting host immune defenses (PubMed:33080218). {By SimilarityUniProtKB:P0C6X7, Experimental EvidencePubMed:32277040, ECO:0000269|PubMed:32358203, ECO:0000269|PubMed:32438371, ECO:0000269|PubMed:32526208, Experimental EvidencePubMed:33080218}. [Non-structural protein 9]: May participate in viral replication by acting as a ssRNA-binding protein (By similarity). Interacts with ribosome signal recognition particle RNA (SRP) (PubMed:33080218). Together with NSP9, suppress protein integration into the cell membrane, thereby disrupting host immune defenses (PubMed:33080218). {By SimilarityUniProtKB:P0C6X7, Experimental EvidencePubMed:33080218}. [Non-structural protein 10]: Plays a pivotal role in viral transcription by stimulating both nsp14 3'-5' exoribonuclease and nsp16 2'-O-methyltransferase activities. Therefore plays an essential role in viral mRNAs cap methylation. {By SimilarityUniProtKB:P0C6X7}. [RNA-directed RNA polymerase nsp12]: Responsible for replication and transcription of the viral RNA genome. {ECO:0000305|PubMed:32277040, ECO:0000305|PubMed:32358203, ECO:0000305|PubMed:32438371, ECO:0000305|PubMed:32526208}. [Helicase nsp13]: Multi-functional protein with a zinc- binding domain in N-terminus displaying RNA and DNA duplex-unwinding activities with 5' to 3' polarity. Activity of helicase is dependent on magnesium (By similarity). Binds to host TBK1 and inhibits TBK1 phosphorylation; the interaction with TBK1 decreases IRF3 phosphorylation, which leads to reduced IFN-beta production (PubMed:32979938). {By SimilarityUniProtKB:P0C6X7, Experimental EvidencePubMed:32979938}. [Proofreading exoribonuclease nsp14]: Enzyme possessing two different activities: an exoribonuclease activity acting on both ssRNA and dsRNA in a 3' to 5' direction and a N7-guanine methyltransferase activity. Acts as a proofreading exoribonuclease for RNA replication, thereby lowering The sensitivity of the virus to RNA mutagens. {By SimilarityUniProtKB:P0C6X7}. [Uridylate-specific endoribonuclease nsp15]: Plays a role in viral transcription/replication and prevents the simultaneous activation of host cell dsRNA sensors, such as MDA5/IFIH1, OAS, and PKR (By similarity). Acts by degrading the 5'-polyuridines generated during replication of the poly(A) region of viral genomic and subgenomic RNAs (PubMed:33504779, PubMed:33564093). Catalyzes a two-step reaction in which a 2'3'-cyclic phosphate (2'3'-cP) is first generated by 2'-O transesterification, which is then hydrolyzed to a 3'-phosphate (3'-P) (PubMed:33504779, PubMed:33564093). If not degraded, poly(U) RNA would hybridize with poly(A) RNA tails and activate host dsRNA sensors (By similarity). {By SimilarityUniProtKB:P0C6X7, ECO:0000269|PubMed:33504779}. [2'-O-methyltransferase nsp16]: Methyltransferase that mediates mRNA cap 2'-O-ribose methylation to the 5'-cap structure of viral mRNAs (By similarity). N7-methyl guanosine cap is a prerequisite for binding of nsp16. Therefore plays an essential role in viral mRNAs cap methylation which is essential to evade immune system (By similarity). May disrupt host mRNA splicing in nucleus by interacting with pre-mRNA Recognition Domains ofthe U1 and U2 snRNAs (PubMed:33080218). {By SimilarityUniProtKB:P0C6X7, Experimental EvidencePubMed:33080218}. | Assigned Ontology terms |
Biological Process | 7-Methylguanosine MRNA Capping (GO:0006370) DNA-Templated Transcription (GO:0006351) Induction By Virus Of Catabolism Of Host MRNA (GO:0039595) Induction By Virus Of Host Autophagy (GO:0039520) Modulation By Virus Of Host Autophagy (GO:0039519) Modulation By Virus Of Host Protein Ubiquitination (GO:0039648) MRNA Methylation (GO:0080009) Positive Regulation Of RNA Biosynthetic Process (GO:1902680) Positive Regulation Of Viral Genome Replication (GO:0045070) Positive Stranded Viral RNA Replication (GO:0039690) Protein Autoprocessing (GO:0016540) Protein K48-Linked Deubiquitination (GO:0071108) Protein K63-Linked Deubiquitination (GO:0070536) Protein Processing (GO:0016485) Proteolysis (GO:0006508) RNA Phosphodiester Bond Hydrolysis, Exonucleolytic (GO:0090503) RNA-Templated Transcription (GO:0001172) Suppression By Virus Of Host Gene Expression (GO:0039657) Suppression By Virus Of Host ISG15-Protein Conjugation (GO:0039579) Suppression By Virus Of Host NF-KappaB Cascade (GO:0039644) Suppression By Virus Of Host Toll-Like Receptor Signaling Pathway (GO:0039722) Suppression By Virus Of Host Translation (GO:0039604) Suppression By Virus Of Host Type I Interferon Production (GO:0039501) Suppression By Virus Of Host Type I Interferon-Mediated Signaling Pathway (GO:0039502) Suppression By Virus Of Host Viral-Induced Cytoplasmic Pattern Recognition Receptor Signaling Pathway Via Inhibition Of IRF3 Activity (GO:0039548) Suppression By Virus Of Host Viral-Induced Cytoplasmic Pattern Recognition Receptor Signaling Pathway Via Inhibition Of TBK1 Activity (GO:0039723) Viral Protein Processing (GO:0019082) Viral Replication Complex Formation And Maintenance (GO:0046786) Viral RNA Genome Replication (GO:0039694) Viral Transcription (GO:0019083) |
Molecular Function | 3'-5'-Exoribonuclease Activity (GO:0000175) 5'-3' RNA Helicase Activity (GO:0032574) ATP Binding (GO:0005524) ATP Hydrolysis Activity (GO:0016887) Cysteine-Type Deubiquitinase Activity (GO:0004843) Cysteine-Type Endopeptidase Activity (GO:0004197) Cysteine-Type Peptidase Activity (GO:0008234) DNA Helicase Activity (GO:0003678) Endoribonuclease Activity, Producing 3'-Phosphomonoesters (GO:0016892) G-Quadruplex RNA Binding (GO:0002151) Helicase Activity (GO:0004386) Identical Protein Binding (GO:0042802) ISG15-Specific Peptidase Activity (GO:0019785) Lyase Activity (GO:0016829) MRNA (Guanine-N7-)-Methyltransferase Activity (GO:0004482) MRNA (Nucleoside-2'-O-)-Methyltransferase Activity (GO:0004483) Omega Peptidase Activity (GO:0008242) Protein Dimerization Activity (GO:0046983) Protein Homodimerization Activity (GO:0042803) RNA Binding (GO:0003723) RNA-Dependent RNA Polymerase Activity (GO:0003968) Single-Stranded RNA Binding (GO:0003727) Zinc Ion Binding (GO:0008270) |
Interactions with Nuclear Envelope proteins (52 interactors) |
|||
---|---|---|---|
Partner (NucEnvDB) | IntAct | Confidence score | |
A0PK00 | Transmembrane protein 120B | EBI-27030072 | 0.35 |
O14657 | Torsin-1B | EBI-27050247 | 0.35 |
O75312 | Zinc finger protein ZPR1 | EBI-27128112 | 0.27 |
Q99720 | Sigma non-opioid intracellular receptor 1 | EBI-25490993 | 0.73 |
Q5JTV8 | Torsin-1A-interacting protein 1 | EBI-25491011 | 0.53 |
P61026 | Ras-related protein Rab-10 | EBI-25491011 | 0.53 |
P0DTD1 | Self | EBI-25506373 | 0.99 |
P63244 | Receptor of activated protein C kinase 1, N-terminally processed | EBI-25509375 | 0.35 |
P57088 | Transmembrane protein 33 | EBI-25509566 | 0.35 |
Q9BTV4 | Transmembrane protein 43 | EBI-26495763 | 0.35 |
P60880 | Synaptosomal-associated protein 25 | EBI-26952878 | 0.56 |
Q9UI30 | Multifunctional methyltransferase subunit TRM112-like protein | EBI-27030072 | 0.35 |
P12931 | Proto-oncogene tyrosine-protein kinase Src | EBI-27092586 | 0.44 |
Q9NRG9 | Aladin | EBI-27030072 | 0.35 |
O95831 | Apoptosis-inducing factor 1, mitochondrial | EBI-25509687 | 0.35 |
Q93084 | Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 | EBI-26496082 | 0.35 |
Q8TD16 | Protein bicaudal D homolog 2 | EBI-27126939 | 0.35 |
P11802 | Cyclin-dependent kinase 4 | EBI-26495747 | 0.35 |
P49454 | Centromere protein F | EBI-25490757 | 0.53 |
Q9BV73 | Centrosome-associated protein CEP250 | EBI-26950012 | 0.56 |
Q96C57 | Protein CUSTOS | EBI-26495696 | 0.35 |
Q9NQC7 | Ubiquitin carboxyl-terminal hydrolase CYLD | EBI-27030072 | 0.35 |
P31689 | DnaJ homolog subfamily A member 1 | EBI-25509375 | 0.35 |
Q96HP0 | Dedicator of cytokinesis protein 6 | EBI-26375521 | 0.35 |
Q15125 | 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase | EBI-25686067 | 0.35 |
O75821 | Eukaryotic translation initiation factor 3 subunit G | EBI-27128043 | 0.27 |
Q8TAG9 | Exocyst complex component 6 | EBI-26951880 | 0.49 |
Q06787 | Fragile X messenger ribonucleoprotein 1 | EBI-25509375 | 0.35 |
P04406 | Glyceraldehyde-3-phosphate dehydrogenase | EBI-25509444 | 0.35 |
Q5T447 | E3 ubiquitin-protein ligase HECTD3 | EBI-27126088 | 0.35 |
Q15056 | Eukaryotic translation initiation factor 4H | EBI-25491191 | 0.64 |
Q9H0H0 | Integrator complex subunit 2 | EBI-26375521 | 0.35 |
Q9Y2M5 | Kelch-like protein 20 | EBI-26949933 | 0.49 |
P42167 | Thymopentin | EBI-27030072 | 0.35 |
P02545 | Lamin-A/C | EBI-27128132 | 0.27 |
Q86UE4 | Protein LYRIC | EBI-25509501 | 0.35 |
Q9Y6D9 | Mitotic spindle assembly checkpoint protein MAD1 | EBI-26950100 | 0.56 |
Q9UM54 | Unconventional myosin-VI | EBI-25509375 | 0.35 |
P0DTC7 | ORF7a protein | EBI-25508859 | 0.62 |
P61970 | Nuclear transport factor 2 | EBI-25490898 | 0.53 |
P57740 | Nuclear pore complex protein Nup107 | EBI-27030072 | 0.35 |
P35658 | Nuclear pore complex protein Nup214 | EBI-25491191 | 0.53 |
Q7Z3B4 | Nucleoporin p54 | EBI-25491191 | 0.53 |
Q9BVL2 | Nucleoporin p58/p45 | EBI-25491191 | 0.53 |
P37198 | Nuclear pore glycoprotein p62 | EBI-25491191 | 0.53 |
Q99567 | Nuclear pore complex protein Nup88 | EBI-25491191 | 0.53 |
Q9UBU9 | Nuclear RNA export factor 1 | EBI-26495696 | 0.35 |
Q8NC51 | Plasminogen activator inhibitor 1 RNA-binding protein | EBI-25509548 | 0.35 |
Q9H7Z7 | Prostaglandin E synthase 2 truncated form | EBI-25491011 | 0.53 |
Q8TEM1 | Nuclear pore membrane glycoprotein 210 | EBI-25490940 | 0.53 |
O75569 | Interferon-inducible double-stranded RNA-dependent protein kinase activator A | EBI-25509874 | 0.35 |
Q6ZRP7 | Sulfhydryl oxidase 2 | EBI-25491011 | 0.53 | Interactions with other proteins (930 interactors) |
Partner (UniProt) | IntAct | Confidence score | |
Q14181 | DNA polymerase alpha subunit B (DNA polymerase alpha 70 kDa subunit) | EBI-25490637 | 0.67 |
P49643 | DNA primase large subunit (DNA primase 58 kDa subunit) (p58) | EBI-25490637 | 0.64 |
P49642 | DNA primase small subunit (EC 2.7.7.102) (DNA primase 49 kDa subunit) (p49) | EBI-25490637 | 0.64 |
P09884 | DNA polymerase alpha catalytic subunit (EC 2.7.7.7) (DNA polymerase alpha catalytic subunit p180) | EBI-25490637 | 0.67 |
Q99959 | Plakophilin-2 | EBI-25490637 | 0.53 |
Q8NBJ5 | Procollagen galactosyltransferase 1 (EC 2.4.1.50) (Collagen beta(1-O)galactosyltransferase 1) (ColGalT 1) (Glycosyltransferase 25 family member 1) (Hydroxylysine galactosyltransferase 1) | EBI-25490637 | 0.53 |
Q9HAV7 | GrpE protein homolog 1, mitochondrial (HMGE) (Mt-GrpE#1) | EBI-25490661 | 0.53 |
Q96CW1 | AP-2 complex subunit mu (AP-2 mu chain) (Adaptin-mu2) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (HA2 50 kDa subunit) (Plasma membrane adaptor AP-2 50 kDa protein) | EBI-25490661 | 0.53 |
Q969X5 | Endoplasmic reticulum-Golgi intermediate compartment protein 1 (ER-Golgi intermediate compartment 32 kDa protein) (ERGIC-32) | EBI-25490661 | 0.53 |
P55789 | FAD-linked sulfhydryl oxidase ALR (EC 1.8.3.2) (Augmenter of liver regeneration) (hERV1) (Hepatopoietin) | EBI-25490661 | 0.53 |
O94973 | AP-2 complex subunit alpha-2 (100 kDa coated vesicle protein C) (Adaptor protein complex AP-2 subunit alpha-2) (Adaptor-related protein complex 2 subunit alpha-2) (Alpha-adaptin C) (Alpha2-adaptin) (Clathrin assembly protein complex 2 alpha-C large chain) (Huntingtin yeast partner J) (Huntingtin-interacting protein 9) (HIP-9) (Huntingtin-interacting protein J) (Plasma membrane adaptor HA2/AP2 adaptin alpha C subunit) | EBI-25490661 | 0.53 |
Q9HAU0 | Pleckstrin homology domain-containing family A member 5 (PH domain-containing family A member 5) (Phosphoinositol 3-phosphate-binding protein 2) (PEPP-2) | EBI-25490691 | 0.53 |
Q9H2H8 | Peptidyl-prolyl cis-trans isomerase-like 3 (PPIase) (EC 5.2.1.8) (Cyclophilin J) (CyPJ) (Cyclophilin-like protein PPIL3) (Rotamase PPIL3) | EBI-25490691 | 0.53 |
Q99081 | Transcription factor 12 (TCF-12) (Class B basic helix-loop-helix protein 20) (bHLHb20) (DNA-binding protein HTF4) (E-box-binding protein) (Transcription factor HTF-4) | EBI-25490691 | 0.53 |
Q96IZ5 | RNA-binding protein 41 (RNA-binding motif protein 41) | EBI-25490691 | 0.53 |
Q92615 | La-related protein 4B (La ribonucleoprotein domain family member 4B) (La ribonucleoprotein domain family member 5) (La-related protein 5) | EBI-25490691 | 0.53 |
Q8IWR0 | Zinc finger CCCH domain-containing protein 7A | EBI-25490691 | 0.53 |
Q70EL1 | Inactive ubiquitin carboxyl-terminal hydrolase 54 (Inactive ubiquitin-specific peptidase 54) | EBI-25490691 | 0.53 |
Q6UUV7 | CREB-regulated transcription coactivator 3 (Transducer of regulated cAMP response element-binding protein 3) (TORC-3) (Transducer of CREB protein 3) | EBI-25490691 | 0.53 |
Q5VUA4 | Zinc finger protein 318 (Endocrine regulatory protein) | EBI-25490691 | 0.53 |
Q5T6F2 | Ubiquitin-associated protein 2 (UBAP-2) | EBI-25490691 | 0.53 |
Q5JSZ5 | Protein PRRC2B (HLA-B-associated transcript 2-like 1) (Proline-rich coiled-coil protein 2B) | EBI-25490691 | 0.53 |
Q5EBL8 | PDZ domain-containing protein 11 (ATPase-interacting PDZ protein) (Plasma membrane calcium ATPase-interacting single-PDZ protein) (PMCA-interacting single-PDZ protein) | EBI-25490691 | 0.53 |
Q2T9J0 | Peroxisomal leader peptide-processing protease (EC 3.4.21.-) (Trypsin domain-containing protein 1) [Cleaved into: Peroxisomal leader peptide-processing protease, 15 kDa form; Peroxisomal leader peptide-processing protease, 45 kDa form] | EBI-25490691 | 0.53 |
Q14157 | Ubiquitin-associated protein 2-like (Protein NICE-4) | EBI-25490691 | 0.53 |
Q13546 | Receptor-interacting serine/threonine-protein kinase 1 (EC 2.7.11.1) (Cell death protein RIP) (Receptor-interacting protein 1) (RIP-1) | EBI-25490691 | 0.72 |
O95391 | Pre-mRNA-splicing factor SLU7 (hSlu7) | EBI-25490691 | 0.53 |
O75592 | E3 ubiquitin-protein ligase MYCBP2 (EC 2.3.2.33) (Myc-binding protein 2) (Protein associated with Myc) | EBI-25490691 | 0.53 |
O43823 | A-kinase anchor protein 8 (AKAP-8) (A-kinase anchor protein 95 kDa) (AKAP 95) | EBI-25490691 | 0.53 |
O14874 | [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial (EC 2.7.11.4) (Branched-chain alpha-ketoacid dehydrogenase kinase) (BCKD-kinase) (BCKDHKIN) | EBI-25490691 | 0.53 |
A3KN83 | Protein strawberry notch homolog 1 (Monocyte protein 3) (MOP-3) | EBI-25490691 | 0.53 |
P17612 | cAMP-dependent protein kinase catalytic subunit alpha (PKA C-alpha) (EC 2.7.11.11) | EBI-25490757 | 0.53 |
O14578 | Citron Rho-interacting kinase (CRIK) (EC 2.7.11.1) (Serine/threonine-protein kinase 21) | EBI-25490757 | 0.53 |
Q9Y2I6 | Ninein-like protein | EBI-25490757 | 0.53 |
Q9UJC3 | Protein Hook homolog 1 (h-hook1) (hHK1) | EBI-25490757 | 0.53 |
Q9UHD2 | Serine/threonine-protein kinase TBK1 (EC 2.7.11.1) (NF-kappa-B-activating kinase) (T2K) (TANK-binding kinase 1) | EBI-25490757 | 0.82 |
Q9BV19 | Uncharacterized protein C1orf50 | EBI-25490757 | 0.53 |
Q9BQS8 | FYVE and coiled-coil domain-containing protein 1 (Zinc finger FYVE domain-containing protein 7) | EBI-25490757 | 0.53 |
Q9BQQ3 | Golgi reassembly-stacking protein 1 (Golgi peripheral membrane protein p65) (Golgi phosphoprotein 5) (GOLPH5) (Golgi reassembly-stacking protein of 65 kDa) (GRASP65) | EBI-25490757 | 0.53 |
Q99996 | A-kinase anchor protein 9 (AKAP-9) (A-kinase anchor protein 350 kDa) (AKAP 350) (hgAKAP 350) (A-kinase anchor protein 450 kDa) (AKAP 450) (AKAP 120-like protein) (Centrosome- and Golgi-localized PKN-associated protein) (CG-NAP) (Protein hyperion) (Protein kinase A-anchoring protein 9) (PRKA9) (Protein yotiao) | EBI-25490757 | 0.53 |
Q96SN8 | CDK5 regulatory subunit-associated protein 2 (CDK5 activator-binding protein C48) (Centrosome-associated protein 215) | EBI-25490757 | 0.53 |
Q96N16 | Janus kinase and microtubule-interacting protein 1 (GABA-B receptor-binding protein) (Multiple alpha-helices and RNA-linker protein 1) (Marlin-1) | EBI-25490757 | 0.53 |
Q96CN9 | GRIP and coiled-coil domain-containing protein 1 (Golgi coiled-coil protein 1) | EBI-25490757 | 0.53 |
Q92995 | Ubiquitin carboxyl-terminal hydrolase 13 (EC 3.4.19.12) (Deubiquitinating enzyme 13) (Isopeptidase T-3) (ISOT-3) (Ubiquitin thioesterase 13) (Ubiquitin-specific-processing protease 13) | EBI-25490757 | 0.67 |
Q8TD10 | Mirror-image polydactyly gene 1 protein | EBI-25490757 | 0.53 |
Q8N8E3 | Centrosomal protein of 112 kDa (Cep112) (Coiled-coil domain-containing protein 46) | EBI-25490757 | 0.53 |
Q8N4C6 | Ninein (hNinein) (Glycogen synthase kinase 3 beta-interacting protein) (GSK3B-interacting protein) | EBI-25490757 | 0.53 |
Q8N3C7 | CAP-Gly domain-containing linker protein 4 (Restin-like protein 2) | EBI-25490757 | 0.53 |
Q8IWJ2 | GRIP and coiled-coil domain-containing protein 2 (185 kDa Golgi coiled-coil protein) (GCC185) (CLL-associated antigen KW-11) (CTCL tumor antigen se1-1) (Ran-binding protein 2-like 4) (RanBP2L4) (Renal carcinoma antigen NY-REN-53) | EBI-25490757 | 0.53 |
Q8IUD2 | ELKS/Rab6-interacting/CAST family member 1 (ERC-1) (Rab6-interacting protein 2) | EBI-25490757 | 0.53 |
Q7Z7A1 | Centriolin (Centrosomal protein 1) (Centrosomal protein of 110 kDa) (Cep110) | EBI-25490757 | 0.53 |
Q76N32 | Centrosomal protein of 68 kDa (Cep68) | EBI-25490757 | 0.53 |
Q66GS9 | Centrosomal protein of 135 kDa (Cep135) (Centrosomal protein 4) | EBI-25490757 | 0.53 |
Q5VU43 | Myomegalin (Cardiomyopathy-associated protein 2) (Phosphodiesterase 4D-interacting protein) | EBI-25490757 | 0.53 |
Q5VT06 | Centrosome-associated protein 350 (Cep350) (Centrosome-associated protein of 350 kDa) | EBI-25490757 | 0.53 |
Q4V328 | GRIP1-associated protein 1 (GRASP-1) [Cleaved into: GRASP-1 C-terminal chain (30kDa C-terminus form)] | EBI-25490757 | 0.53 |
Q14789 | Golgin subfamily B member 1 (372 kDa Golgi complex-associated protein) (GCP372) (Giantin) (Macrogolgin) | EBI-25490757 | 0.53 |
Q08379 | Golgin subfamily A member 2 (130 kDa cis-Golgi matrix protein) (GM130) (GM130 autoantigen) (Golgin-95) | EBI-26950045 | 0.56 |
Q08378 | Golgin subfamily A member 3 (Golgi complex-associated protein of 170 kDa) (GCP170) (Golgin-160) | EBI-25490757 | 0.53 |
Q08117 | TLE family member 5 (Amino-terminal enhancer of split) (Amino enhancer of split) (Gp130-associated protein GAM) (Grg-5) (Groucho-related protein 5) (Protein ESP1) (Protein GRG) (TLE family member 5, transcriptional modulator) | EBI-25490757 | 0.53 |
Q04726 | Transducin-like enhancer protein 3 (Enhancer of split groucho-like protein 3) (ESG3) | EBI-25490757 | 0.53 |
Q04724 | Transducin-like enhancer protein 1 (E(Sp1) homolog) (Enhancer of split groucho-like protein 1) (ESG1) | EBI-25490757 | 0.53 |
P35241 | Radixin | EBI-25490757 | 0.53 |
P31323 | cAMP-dependent protein kinase type II-beta regulatory subunit | EBI-25490757 | 0.53 |
P13861 | cAMP-dependent protein kinase type II-alpha regulatory subunit | EBI-25490757 | 0.53 |
O95684 | Centrosomal protein 43 (FGFR1 oncogene partner) | EBI-25490757 | 0.53 |
O95613 | Pericentrin (Kendrin) (Pericentrin-B) | EBI-25490757 | 0.53 |
O75506 | Heat shock factor-binding protein 1 (Nasopharyngeal carcinoma-associated antigen 13) (NPC-A-13) | EBI-25490757 | 0.53 |
A7MCY6 | TANK-binding kinase 1-binding protein 1 (TBK1-binding protein 1) | EBI-25490757 | 0.53 |
Q9NXA8 | NAD-dependent protein deacylase sirtuin-5, mitochondrial (EC 2.3.1.-) (Regulatory protein SIR2 homolog 5) (SIR2-like protein 5) | EBI-25490883 | 0.64 |
P12268 | Inosine-5'-monophosphate dehydrogenase 2 (IMP dehydrogenase 2) (IMPD 2) (IMPDH 2) (EC 1.1.1.205) (Inosine-5'-monophosphate dehydrogenase type II) (IMP dehydrogenase II) (IMPDH-II) | EBI-25490883 | 0.53 |
P06280 | Alpha-galactosidase A (EC 3.2.1.22) (Alpha-D-galactosidase A) (Alpha-D-galactoside galactohydrolase) (Galactosylgalactosylglucosylceramidase GLA) (Melibiase) (Agalsidase) | EBI-25490883 | 0.53 |
P07203 | Glutathione peroxidase 1 (GPx-1) (GSHPx-1) (EC 1.11.1.9) (Cellular glutathione peroxidase) | EBI-25490979 | 0.53 |
Q9NXH9 | tRNA (guanine(26)-N(2))-dimethyltransferase (EC 2.1.1.216) (tRNA 2,2-dimethylguanosine-26 methyltransferase) (tRNA(guanine-26,N(2)-N(2)) methyltransferase) (tRNA(m(2,2)G26)dimethyltransferase) | EBI-25490979 | 0.53 |
Q9H7F0 | Polyamine-transporting ATPase 13A3 (ATPase family homolog up-regulated in senescence cells 1) (Putrescine transporting ATPase) (EC 7.6.2.16) | EBI-25490993 | 0.73 |
Q15904 | V-type proton ATPase subunit S1 (V-ATPase subunit S1) (Protein XAP-3) (V-ATPase Ac45 subunit) (V-ATPase S1 accessory protein) (Vacuolar proton pump subunit S1) | EBI-25490993 | 0.83 |
O75964 | ATP synthase subunit g, mitochondrial (ATPase subunit g) (ATP synthase membrane subunit g) | EBI-25490993 | 0.53 |
Q92769 | Histone deacetylase 2 (HD2) (EC 3.5.1.98) (Protein deacylase HDAC2) (EC 3.5.1.-) | EBI-25490970 | 0.59 |
Q8WVC6 | Dephospho-CoA kinase domain-containing protein | EBI-25491011 | 0.53 |
Q9NP72 | Ras-related protein Rab-18 | EBI-25491011 | 0.53 |
Q9BQE4 | Selenoprotein S (SelS) (VCP-interacting membrane protein) | EBI-25491011 | 0.53 |
Q96DA6 | Mitochondrial import inner membrane translocase subunit TIM14 (DnaJ homolog subfamily C member 19) | EBI-25491011 | 0.53 |
Q96A26 | Protein FAM162A (E2-induced gene 5 protein) (Growth and transformation-dependent protein) (HGTD-P) | EBI-25491011 | 0.53 |
Q8WUY8 | Probable N-acetyltransferase 14 (EC 2.3.1.-) (K562 cell-derived leucine-zipper-like protein 1) | EBI-25491011 | 0.53 |
Q8WTV0 | Scavenger receptor class B member 1 (SRB1) (CD36 and LIMPII analogous 1) (CLA-1) (CD36 antigen-like 1) (Collagen type I receptor, thrombospondin receptor-like 1) (SR-BI) (CD antigen CD36) | EBI-25491011 | 0.53 |
Q8NBX0 | Saccharopine dehydrogenase-like oxidoreductase (EC 1.-.-.-) | EBI-25491011 | 0.53 |
Q8N183 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2 (B17.2-like) (B17.2L) (Mimitin) (Myc-induced mitochondrial protein) (MMTN) (NDUFA12-like protein) | EBI-25491011 | 0.53 |
Q7LGA3 | Heparan sulfate 2-O-sulfotransferase 1 (2-O-sulfotransferase) (2OST) (EC 2.8.2.-) | EBI-25491011 | 0.53 |
Q5VT66 | Mitochondrial amidoxime-reducing component 1 (mARC1) (EC 1.7.-.-) (Molybdenum cofactor sulfurase C-terminal domain-containing protein 1) (MOSC domain-containing protein 1) (Moco sulfurase C-terminal domain-containing protein 1) | EBI-25491011 | 0.53 |
Q13724 | Mannosyl-oligosaccharide glucosidase (EC 3.2.1.106) (Processing A-glucosidase I) | EBI-25491011 | 0.53 |
Q12907 | Vesicular integral-membrane protein VIP36 (Glycoprotein GP36b) (Lectin mannose-binding 2) (Vesicular integral-membrane protein 36) (VIP36) | EBI-25491011 | 0.53 |
P63218 | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 | EBI-25491011 | 0.53 |
P62873 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 (Transducin beta chain 1) | EBI-25491011 | 0.53 |
P62820 | Ras-related protein Rab-1A (EC 3.6.5.2) (YPT1-related protein) | EBI-25491011 | 0.53 |
P61586 | Transforming protein RhoA (EC 3.6.5.2) (Rho cDNA clone 12) (h12) | EBI-25491011 | 0.53 |
P61106 | Ras-related protein Rab-14 | EBI-25491011 | 0.53 |
P61019 | Ras-related protein Rab-2A (EC 3.6.5.2) | EBI-25491011 | 0.53 |
P61006 | Ras-related protein Rab-8A (EC 3.6.5.2) (Oncogene c-mel) | EBI-25491011 | 0.53 |
P51149 | Ras-related protein Rab-7a (EC 3.6.5.2) | EBI-25491011 | 0.53 |
P51148 | Ras-related protein Rab-5C (EC 3.6.5.2) (L1880) (RAB5L) | EBI-25491011 | 0.53 |
P21964 | Catechol O-methyltransferase (EC 2.1.1.6) | EBI-25491011 | 0.53 |
P11233 | Ras-related protein Ral-A (EC 3.6.5.2) | EBI-25491011 | 0.53 |
P00387 | NADH-cytochrome b5 reductase 3 (B5R) (Cytochrome b5 reductase) (EC 1.6.2.2) (Diaphorase-1) | EBI-25491011 | 0.53 |
O95573 | Fatty acid CoA ligase Acsl3 (Arachidonate--CoA ligase) (EC 6.2.1.15) (Long-chain acyl-CoA synthetase 3) (LACS 3) (Long-chain-fatty-acid--CoA ligase 3) (EC 6.2.1.3) (Medium-chain acyl-CoA ligase Acsl3) (EC 6.2.1.2) | EBI-25491011 | 0.53 |
O43169 | Cytochrome b5 type B (Cytochrome b5 outer mitochondrial membrane isoform) | EBI-25491011 | 0.53 |
O00116 | Alkyldihydroxyacetonephosphate synthase, peroxisomal (Alkyl-DHAP synthase) (EC 2.5.1.26) (Aging-associated gene 5 protein) (Alkylglycerone-phosphate synthase) | EBI-25491011 | 0.53 |
Q9H4P4 | E3 ubiquitin-protein ligase NRDP1 (EC 2.3.2.27) (RING finger protein 41) (RING-type E3 ubiquitin transferase NRDP1) | EBI-25490898 | 0.53 |
P62330 | ADP-ribosylation factor 6 (EC 3.6.5.2) | EBI-25490898 | 0.53 |
Q6Y7W6 | GRB10-interacting GYF protein 2 (PERQ amino acid-rich with GYF domain-containing protein 2) (Trinucleotide repeat-containing gene 15 protein) | EBI-25490913 | 0.64 |
Q5T1M5 | FK506-binding protein 15 (FKBP-15) (133 kDa FK506-binding protein) (133 kDa FKBP) (FKBP-133) (WASP- and FKBP-like protein) (WAFL) | EBI-25490913 | 0.64 |
Q2M389 | WASH complex subunit 4 (Strumpellin and WASH-interacting protein) (SWIP) (WASH complex subunit SWIP) | EBI-25490913 | 0.53 |
P52306 | Rap1 GTPase-GDP dissociation stimulator 1 (Exchange factor smgGDS) (SMG GDS protein) (SMG P21 stimulatory GDP/GTP exchange protein) | EBI-25490913 | 0.78 |
P16435 | NADPH--cytochrome P450 reductase (CPR) (P450R) (EC 1.6.2.4) | EBI-25490913 | 0.53 |
O60573 | Eukaryotic translation initiation factor 4E type 2 (eIF-4E type 2) (eIF4E type 2) (Eukaryotic translation initiation factor 4E homologous protein) (Eukaryotic translation initiation factor 4E-like 3) (eIF4E-like protein 4E-LP) (mRNA cap-binding protein 4EHP) (h4EHP) (mRNA cap-binding protein type 3) | EBI-25490913 | 0.53 |
O14975 | Long-chain fatty acid transport protein 2 (Arachidonate--CoA ligase) (EC 6.2.1.15) (Fatty acid transport protein 2) (FATP-2) (Fatty-acid-coenzyme A ligase, very long-chain 1) (Long-chain-fatty-acid--CoA ligase) (EC 6.2.1.3) (Phytanate--CoA ligase) (EC 6.2.1.24) (Solute carrier family 27 member 2) (THCA-CoA ligase) (EC 6.2.1.7) (Very long-chain acyl-CoA synthetase) (VLACS) (VLCS) (EC 6.2.1.-) (Very long-chain-fatty-acid-CoA ligase) | EBI-25490913 | 0.53 |
Q9Y5J7 | Mitochondrial import inner membrane translocase subunit Tim9 | EBI-25490940 | 0.53 |
Q9Y5J6 | Mitochondrial import inner membrane translocase subunit Tim10 B (Fracture callus protein 1) (FxC1) (Mitochondrial import inner membrane translocase subunit Tim9 B) (TIMM10B) (Tim10b) | EBI-25490940 | 0.53 |
Q9NVH1 | DnaJ homolog subfamily C member 11 | EBI-25490940 | 0.53 |
Q9BSF4 | Mitochondrial import inner membrane translocase subunit Tim29 (TIM29) | EBI-25490940 | 0.53 |
Q2TAA5 | GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase (EC 2.4.1.131) (Asparagine-linked glycosylation protein 11 homolog) (Glycolipid 2-alpha-mannosyltransferase) | EBI-25490940 | 0.53 |
P62072 | Mitochondrial import inner membrane translocase subunit Tim10 | EBI-25490940 | 0.53 |
P14735 | Insulin-degrading enzyme (EC 3.4.24.56) (Abeta-degrading protease) (Insulin protease) (Insulinase) (Insulysin) | EBI-25490940 | 0.53 |
Q9HD40 | O-phosphoseryl-tRNA(Sec) selenium transferase (EC 2.9.1.2) (Liver-pancreas antigen) (LP) (SLA-p35) (SLA/LP autoantigen) (Selenocysteine synthase) (Sec synthase) (Selenocysteinyl-tRNA(Sec) synthase) (Sep-tRNA:Sec-tRNA synthase) (SepSecS) (Soluble liver antigen) (SLA) (UGA suppressor tRNA-associated protein) (tRNA(Ser/Sec)-associated antigenic protein) | EBI-25491113 | 0.53 |
Q9BSC4 | Nucleolar protein 10 | EBI-25491113 | 0.53 |
Q92552 | 28S ribosomal protein S27, mitochondrial (MRP-S27) (S27mt) (Mitochondrial ribosomal protein S27) (Mitochondrial small ribosomal subunit protein mS27) | EBI-25491113 | 0.53 |
Q13868 | Exosome complex component RRP4 (Exosome component 2) (Ribosomal RNA-processing protein 4) | EBI-25491113 | 0.53 |
P82675 | 28S ribosomal protein S5, mitochondrial (MRP-S5) (S5mt) (Mitochondrial small ribosomal subunit protein uS5m) | EBI-25491113 | 0.53 |
Q9Y399 | 28S ribosomal protein S2, mitochondrial (MRP-S2) (S2mt) (Mitochondrial small ribosomal subunit protein uS2m) | EBI-25491113 | 0.53 |
Q9ULT8 | E3 ubiquitin-protein ligase HECTD1 (EC 2.3.2.26) (E3 ligase for inhibin receptor) (EULIR) (HECT domain-containing protein 1) | EBI-25491113 | 0.64 |
Q9NY61 | Protein AATF (Apoptosis-antagonizing transcription factor) (Rb-binding protein Che-1) | EBI-25491113 | 0.53 |
Q9NQT5 | Exosome complex component RRP40 (Exosome component 3) (Ribosomal RNA-processing protein 40) (p10) | EBI-25491113 | 0.53 |
Q9NQT4 | Exosome complex component RRP46 (Chronic myelogenous leukemia tumor antigen 28) (Exosome component 5) (Ribosomal RNA-processing protein 46) (p12B) | EBI-25491113 | 0.53 |
Q9H6F5 | Coiled-coil domain-containing protein 86 (Cytokine-induced protein with coiled-coil domain) | EBI-25491113 | 0.53 |
Q96I59 | Probable asparagine--tRNA ligase, mitochondrial (EC 6.1.1.22) (Asparaginyl-tRNA synthetase) (AsnRS) | EBI-25491113 | 0.53 |
Q96B26 | Exosome complex component RRP43 (Exosome component 8) (Opa-interacting protein 2) (OIP-2) (Ribosomal RNA-processing protein 43) (p9) | EBI-25491113 | 0.53 |
Q8NEJ9 | Neuroguidin (Centromere accumulated nuclear protein 1) (CANu1) (EIF4E-binding protein) | EBI-25491113 | 0.53 |
Q7L2J0 | 7SK snRNA methylphosphate capping enzyme (MePCE) (EC 2.1.1.-) (Bicoid-interacting protein 3 homolog) (Bin3 homolog) | EBI-25491113 | 0.53 |
Q4G0J3 | La-related protein 7 (La ribonucleoprotein domain family member 7) (hLARP7) (P-TEFb-interaction protein for 7SK stability) (PIP7S) | EBI-25491113 | 0.53 |
Q13206 | Probable ATP-dependent RNA helicase DDX10 (EC 3.6.4.13) (DEAD box protein 10) | EBI-25491113 | 0.53 |
P82663 | 28S ribosomal protein S25, mitochondrial (MRP-S25) (S25mt) (Mitochondrial small ribosomal subunit protein mS25) | EBI-25491113 | 0.53 |
P61011 | Signal recognition particle 54 kDa protein (SRP54) (EC 3.6.5.-) | EBI-25491113 | 0.53 |
P09132 | Signal recognition particle 19 kDa protein (SRP19) | EBI-25491113 | 0.53 |
O96028 | Histone-lysine N-methyltransferase NSD2 (EC 2.1.1.357) (Multiple myeloma SET domain-containing protein) (MMSET) (Nuclear SET domain-containing protein 2) (Protein trithorax-5) (Wolf-Hirschhorn syndrome candidate 1 protein) | EBI-25491113 | 0.53 |
O95260 | Arginyl-tRNA--protein transferase 1 (Arginyltransferase 1) (R-transferase 1) (EC 2.3.2.8) (Arginine-tRNA--protein transferase 1) | EBI-25491113 | 0.64 |
O76094 | Signal recognition particle subunit SRP72 (SRP72) (Signal recognition particle 72 kDa protein) | EBI-25491113 | 0.53 |
O00566 | U3 small nucleolar ribonucleoprotein protein MPP10 (M phase phosphoprotein 10) | EBI-25491113 | 0.53 |
P35556 | Fibrillin-2 [Cleaved into: Placensin] | EBI-25491191 | 0.53 |
Q9UBX5 | Fibulin-5 (FIBL-5) (Developmental arteries and neural crest EGF-like protein) (Dance) (Urine p50 protein) (UP50) | EBI-25491191 | 0.53 |
Q9NZL9 | Methionine adenosyltransferase 2 subunit beta (Methionine adenosyltransferase II beta) (MAT II beta) (Putative dTDP-4-keto-6-deoxy-D-glucose 4-reductase) | EBI-25491191 | 0.53 |
Q96F45 | Zinc finger protein 503 | EBI-25491191 | 0.53 |
Q8TD19 | Serine/threonine-protein kinase Nek9 (EC 2.7.11.1) (Nercc1 kinase) (Never in mitosis A-related kinase 9) (NimA-related protein kinase 9) (NimA-related kinase 8) (Nek8) | EBI-25491191 | 0.64 |
Q8N0X7 | Spartin (Spastic paraplegia 20 protein) (Trans-activated by hepatitis C virus core protein 1) | EBI-25491191 | 0.64 |
Q86YT6 | E3 ubiquitin-protein ligase MIB1 (EC 2.3.2.27) (DAPK-interacting protein 1) (DIP-1) (Mind bomb homolog 1) (RING-type E3 ubiquitin transferase MIB1) (Zinc finger ZZ type with ankyrin repeat domain protein 2) | EBI-25491191 | 0.67 |
P61962 | DDB1- and CUL4-associated factor 7 (WD repeat-containing protein 68) (WD repeat-containing protein An11 homolog) | EBI-25491191 | 0.53 |
P35555 | Fibrillin-1 [Cleaved into: Asprosin] | EBI-25491191 | 0.53 |
P13984 | General transcription factor IIF subunit 2 (General transcription factor IIF 30 kDa subunit) (Transcription initiation factor IIF subunit beta) (TFIIF-beta) (Transcription initiation factor RAP30) | EBI-25491191 | 0.73 |
P0DTD8 | ORF7b protein (ORF7b) (Accessory protein 7b) | EBI-25508759 | 0.55 |
P0DTC9 | Nucleoprotein (N) (Nucleocapsid protein) (NC) (Protein N) | EBI-27052424 | 0.66 |
P0DTC3 | ORF3a protein (ORF3a) (Accessory protein 3a) (Protein 3a) (Protein U274) (Protein X1) | EBI-26953433 | 0.49 |
P0DTC6 | ORF6 protein (ORF6) (Accessory protein 6) (Non-structural protein 6) (ns6) (Protein X3) | EBI-26953705 | 0.49 |
P0DTC8 | ORF8 protein (ORF8) (Non-structural protein 8) (ns8) | EBI-25508863 | 0.37 |
O15226 | NF-kappa-B-repressing factor (NFkB-repressing factor) (NRF) (Protein ITBA4) | EBI-25508881 | 0.50 |
P55884 | Eukaryotic translation initiation factor 3 subunit B (eIF3b) (Eukaryotic translation initiation factor 3 subunit 9) (Prt1 homolog) (hPrt1) (eIF-3-eta) (eIF3 p110) (eIF3 p116) | EBI-25508895 | 0.53 |
P08865 | 40S ribosomal protein SA (37 kDa laminin receptor precursor) (37LRP) (37/67 kDa laminin receptor) (LRP/LR) (67 kDa laminin receptor) (67LR) (Colon carcinoma laminin-binding protein) (Laminin receptor 1) (LamR) (Laminin-binding protein precursor p40) (LBP/p40) (Multidrug resistance-associated protein MGr1-Ag) (NEM/1CHD4) (Small ribosomal subunit protein uS2) | EBI-25508895 | 0.53 |
P60228 | Eukaryotic translation initiation factor 3 subunit E (eIF3e) (Eukaryotic translation initiation factor 3 subunit 6) (Viral integration site protein INT-6 homolog) (eIF-3 p48) | EBI-25508895 | 0.53 |
P35251 | Replication factor C subunit 1 (Activator 1 140 kDa subunit) (A1 140 kDa subunit) (Activator 1 large subunit) (Activator 1 subunit 1) (DNA-binding protein PO-GA) (Replication factor C 140 kDa subunit) (RF-C 140 kDa subunit) (RFC140) (Replication factor C large subunit) | EBI-25508903 | 0.35 |
P46782 | 40S ribosomal protein S5 (Small ribosomal subunit protein uS7) [Cleaved into: 40S ribosomal protein S5, N-terminally processed] | EBI-25508903 | 0.35 |
P46783 | 40S ribosomal protein S10 (Small ribosomal subunit protein eS10) | EBI-25508903 | 0.35 |
O76021 | Ribosomal L1 domain-containing protein 1 (CATX-11) (Cellular senescence-inhibited gene protein) (Protein PBK1) | EBI-25508903 | 0.35 |
Q9BUJ2 | Heterogeneous nuclear ribonucleoprotein U-like protein 1 (Adenovirus early region 1B-associated protein 5) (E1B-55 kDa-associated protein 5) (E1B-AP5) | EBI-25508903 | 0.35 |
Q9BZE4 | GTP-binding protein 4 (Chronic renal failure gene protein) (GTP-binding protein NGB) (Nucleolar GTP-binding protein 1) | EBI-25508903 | 0.35 |
O95757 | Heat shock 70 kDa protein 4L (Heat shock 70-related protein APG-1) (Heat-shock protein family A member 4-like protein) (HSPA4-like protein) (Osmotic stress protein 94) | EBI-25508903 | 0.35 |
P82650 | 28S ribosomal protein S22, mitochondrial (MRP-S22) (S22mt) (Mitochondrial small ribosomal subunit protein mS22) | EBI-25508903 | 0.35 |
P53007 | Tricarboxylate transport protein, mitochondrial (Citrate transport protein) (CTP) (Mitochondrial citrate carrier) (CIC) (Solute carrier family 25 member 1) (Tricarboxylate carrier protein) | EBI-25508903 | 0.35 |
P26599 | Polypyrimidine tract-binding protein 1 (PTB) (57 kDa RNA-binding protein PPTB-1) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) | EBI-25508903 | 0.35 |
P05023 | Sodium/potassium-transporting ATPase subunit alpha-1 (Na(+)/K(+) ATPase alpha-1 subunit) (EC 7.2.2.13) (Sodium pump subunit alpha-1) | EBI-25508903 | 0.35 |
P16615 | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2) (SR Ca(2+)-ATPase 2) (EC 7.2.2.10) (Calcium pump 2) (Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform) (Endoplasmic reticulum class 1/2 Ca(2+) ATPase) | EBI-25508903 | 0.35 |
P34932 | Heat shock 70 kDa protein 4 (HSP70RY) (Heat shock 70-related protein APG-2) | EBI-25508903 | 0.35 |
O00411 | DNA-directed RNA polymerase, mitochondrial (MtRPOL) (EC 2.7.7.6) | EBI-25508903 | 0.35 |
Q9UNQ2 | Probable dimethyladenosine transferase (EC 2.1.1.183) (DIM1 dimethyladenosine transferase 1 homolog) (DIM1 dimethyladenosine transferase 1-like) (Probable 18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase) (Probable 18S rRNA dimethylase) (Probable S-adenosylmethionine-6-N',N'-adenosyl(rRNA) dimethyltransferase) | EBI-25508903 | 0.35 |
Q9H0A0 | RNA cytidine acetyltransferase (EC 2.3.1.-) (18S rRNA cytosine acetyltransferase) (N-acetyltransferase 10) (N-acetyltransferase-like protein) (hALP) | EBI-25508903 | 0.35 |
Q96CS3 | FAS-associated factor 2 (Protein ETEA) (UBX domain-containing protein 3B) (UBX domain-containing protein 8) | EBI-25508903 | 0.35 |
P50991 | T-complex protein 1 subunit delta (TCP-1-delta) (CCT-delta) (Stimulator of TAR RNA-binding) | EBI-25509375 | 0.35 |
P06576 | ATP synthase subunit beta, mitochondrial (EC 7.1.2.2) (ATP synthase F1 subunit beta) | EBI-25686067 | 0.53 |
P25705 | ATP synthase subunit alpha, mitochondrial (ATP synthase F1 subunit alpha) | EBI-25509375 | 0.35 |
P25205 | DNA replication licensing factor MCM3 (EC 3.6.4.12) (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3) (RLF subunit beta) (p102) | EBI-25509375 | 0.35 |
P40227 | T-complex protein 1 subunit zeta (TCP-1-zeta) (Acute morphine dependence-related protein 2) (CCT-zeta-1) (HTR3) (Tcp20) | EBI-25509375 | 0.35 |
P48643 | T-complex protein 1 subunit epsilon (TCP-1-epsilon) (CCT-epsilon) | EBI-25509375 | 0.35 |
P22314 | Ubiquitin-like modifier-activating enzyme 1 (EC 6.2.1.45) (Protein A1S9) (Ubiquitin-activating enzyme E1) | EBI-25509375 | 0.35 |
P53621 | Coatomer subunit alpha (Alpha-coat protein) (Alpha-COP) (HEP-COP) (HEPCOP) [Cleaved into: Xenin (Xenopsin-related peptide); Proxenin] | EBI-25509375 | 0.35 |
P61158 | Actin-related protein 3 (Actin-like protein 3) | EBI-25509935 | 0.40 |
Q16875 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (6PF-2-K/Fru-2,6-P2ase 3) (PFK/FBPase 3) (6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme) (Renal carcinoma antigen NY-REN-56) (iPFK-2) [Includes: 6-phosphofructo-2-kinase (EC 2.7.1.105); Fructose-2,6-bisphosphatase (EC 3.1.3.46)] | EBI-25509375 | 0.35 |
P62195 | 26S proteasome regulatory subunit 8 (26S proteasome AAA-ATPase subunit RPT6) (Proteasome 26S subunit ATPase 5) (Proteasome subunit p45) (Thyroid hormone receptor-interacting protein 1) (TRIP1) (p45/SUG) | EBI-25509444 | 0.35 |
P62269 | 40S ribosomal protein S18 (Ke-3) (Ke3) (Small ribosomal subunit protein uS13) | EBI-25509444 | 0.35 |
Q96N67 | Dedicator of cytokinesis protein 7 | EBI-25509444 | 0.35 |
P19105 | Myosin regulatory light chain 12A (Epididymis secretory protein Li 24) (HEL-S-24) (MLC-2B) (Myosin RLC) (Myosin regulatory light chain 2, nonsarcomeric) (Myosin regulatory light chain MRLC3) | EBI-25509444 | 0.35 |
P60660 | Myosin light polypeptide 6 (17 kDa myosin light chain) (LC17) (Myosin light chain 3) (MLC-3) (Myosin light chain alkali 3) (Myosin light chain A3) (Smooth muscle and nonmuscle myosin light chain alkali 6) | EBI-25509444 | 0.35 |
P35998 | 26S proteasome regulatory subunit 7 (26S proteasome AAA-ATPase subunit RPT1) (Proteasome 26S subunit ATPase 2) | EBI-25509444 | 0.35 |
Q9NTJ3 | Structural maintenance of chromosomes protein 4 (SMC protein 4) (SMC-4) (Chromosome-associated polypeptide C) (hCAP-C) (XCAP-C homolog) | EBI-25509444 | 0.35 |
Q9NZ01 | Very-long-chain enoyl-CoA reductase (EC 1.3.1.93) (Synaptic glycoprotein SC2) (Trans-2,3-enoyl-CoA reductase) (TER) | EBI-25509444 | 0.35 |
Q16891 | MICOS complex subunit MIC60 (Cell proliferation-inducing gene 4/52 protein) (Mitochondrial inner membrane protein) (Mitofilin) (p87/89) | EBI-25509444 | 0.35 |
Q9P035 | Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 (EC 4.2.1.134) (3-hydroxyacyl-CoA dehydratase 3) (HACD3) (Butyrate-induced protein 1) (B-ind1) (hB-ind1) (Protein-tyrosine phosphatase-like A domain-containing protein 1) | EBI-25509444 | 0.35 |
P09012 | U1 small nuclear ribonucleoprotein A (U1 snRNP A) (U1-A) (U1A) | EBI-25509501 | 0.35 |
P35250 | Replication factor C subunit 2 (Activator 1 40 kDa subunit) (A1 40 kDa subunit) (Activator 1 subunit 2) (Replication factor C 40 kDa subunit) (RF-C 40 kDa subunit) (RFC40) | EBI-25509501 | 0.35 |
Q9NXF1 | Testis-expressed protein 10 | EBI-25509501 | 0.35 |
Q9H5H4 | Zinc finger protein 768 | EBI-25509501 | 0.35 |
P16989 | Y-box-binding protein 3 (Cold shock domain-containing protein A) (DNA-binding protein A) (Single-strand DNA-binding protein NF-GMB) | EBI-25509501 | 0.35 |
P25398 | 40S ribosomal protein S12 (Small ribosomal subunit protein eS12) | EBI-25509501 | 0.35 |
Q14498 | RNA-binding protein 39 (CAPER alpha) (CAPERalpha) (Hepatocellular carcinoma protein 1) (RNA-binding motif protein 39) (RNA-binding region-containing protein 2) (Splicing factor HCC1) | EBI-25509501 | 0.35 |
Q9UHX1 | Poly(U)-binding-splicing factor PUF60 (60 kDa poly(U)-binding-splicing factor) (FUSE-binding protein-interacting repressor) (FBP-interacting repressor) (Ro-binding protein 1) (RoBP1) (Siah-binding protein 1) (Siah-BP1) | EBI-25509501 | 0.35 |
Q9NW13 | RNA-binding protein 28 (RNA-binding motif protein 28) | EBI-25509501 | 0.35 |
O43660 | Pleiotropic regulator 1 | EBI-25509501 | 0.35 |
Q7Z2T5 | TRMT1-like protein (EC 2.1.1.-) | EBI-25509501 | 0.35 |
O15381 | Nuclear valosin-containing protein-like (NVLp) (Nuclear VCP-like protein) | EBI-25509501 | 0.35 |
Q9NX58 | Cell growth-regulating nucleolar protein | EBI-25509501 | 0.35 |
O43395 | U4/U6 small nuclear ribonucleoprotein Prp3 (Pre-mRNA-splicing factor 3) (hPrp3) (U4/U6 snRNP 90 kDa protein) | EBI-25509501 | 0.35 |
Q13610 | Periodic tryptophan protein 1 homolog (Keratinocyte protein IEF SSP 9502) | EBI-25509501 | 0.35 |
O00567 | Nucleolar protein 56 (Nucleolar protein 5A) | EBI-25509501 | 0.35 |
Q9UKD2 | mRNA turnover protein 4 homolog (Ribosome assembly factor MRTO4) | EBI-25509501 | 0.35 |
P11387 | DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I) | EBI-25509501 | 0.35 |
P46013 | Proliferation marker protein Ki-67 (Antigen identified by monoclonal antibody Ki-67) (Antigen KI-67) (Antigen Ki67) | EBI-25509501 | 0.35 |
Q9UJV9 | Probable ATP-dependent RNA helicase DDX41 (EC 3.6.4.13) (DEAD box protein 41) (DEAD box protein abstrakt homolog) | EBI-25509501 | 0.35 |
Q13523 | Serine/threonine-protein kinase PRP4 homolog (EC 2.7.11.1) (PRP4 kinase) (PRP4 pre-mRNA-processing factor 4 homolog) | EBI-25509501 | 0.35 |
P42696 | RNA-binding protein 34 (RNA-binding motif protein 34) | EBI-25509501 | 0.35 |
O95104 | SR-related and CTD-associated factor 4 (CTD-binding SR-like protein RA4) (Splicing factor, arginine/serine-rich 15) | EBI-25509501 | 0.35 |
Q8N5C6 | S1 RNA-binding domain-containing protein 1 | EBI-25509501 | 0.35 |
Q9GZR7 | ATP-dependent RNA helicase DDX24 (EC 3.6.4.13) (DEAD box protein 24) | EBI-25509501 | 0.35 |
Q12788 | Transducin beta-like protein 3 (WD repeat-containing protein SAZD) | EBI-25509501 | 0.35 |
P40938 | Replication factor C subunit 3 (Activator 1 38 kDa subunit) (A1 38 kDa subunit) (Activator 1 subunit 3) (Replication factor C 38 kDa subunit) (RF-C 38 kDa subunit) (RFC38) | EBI-25509501 | 0.35 |
Q9HC36 | rRNA methyltransferase 3, mitochondrial (EC 2.1.1.-) (16S rRNA (guanosine(1370)-2'-O)-methyltransferase) (16S rRNA [Gm1370] 2'-O-methyltransferase) (RNA methyltransferase-like protein 1) | EBI-25509501 | 0.35 |
Q00325 | Phosphate carrier protein, mitochondrial (Phosphate transport protein) (PTP) (Solute carrier family 25 member 3) | EBI-25509566 | 0.35 |
P55786 | Puromycin-sensitive aminopeptidase (PSA) (EC 3.4.11.14) (Cytosol alanyl aminopeptidase) (AAP-S) | EBI-25509566 | 0.35 |
O43592 | Exportin-T (Exportin(tRNA)) (tRNA exportin) | EBI-25509566 | 0.35 |
O14980 | Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog) | EBI-25509566 | 0.35 |
P30043 | Flavin reductase (NADPH) (FR) (EC 1.5.1.30) (Biliverdin reductase B) (BVR-B) (EC 1.3.1.24) (Biliverdin-IX beta-reductase) (Green heme-binding protein) (GHBP) (NADPH-dependent diaphorase) (NADPH-flavin reductase) (FLR) | EBI-25509566 | 0.35 |
Q99460 | 26S proteasome non-ATPase regulatory subunit 1 (26S proteasome regulatory subunit RPN2) (26S proteasome regulatory subunit S1) (26S proteasome subunit p112) | EBI-25509603 | 0.35 |
P53396 | ATP-citrate synthase (EC 2.3.3.8) (ATP-citrate (pro-S-)-lyase) (ACL) (Citrate cleavage enzyme) | EBI-25509603 | 0.35 |
P22234 | Bifunctional phosphoribosylaminoimidazole carboxylase/phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS) [Includes: Phosphoribosylaminoimidazole carboxylase (EC 4.1.1.21) (AIR carboxylase) (AIRC); Phosphoribosylaminoimidazole succinocarboxamide synthetase (EC 6.3.2.6) (SAICAR synthetase)] | EBI-27092549 | 0.44 |
Q9NNW5 | WD repeat-containing protein 6 | EBI-25509603 | 0.35 |
P06733 | Alpha-enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (C-myc promoter-binding protein) (Enolase 1) (MBP-1) (MPB-1) (Non-neural enolase) (NNE) (Phosphopyruvate hydratase) (Plasminogen-binding protein) | EBI-25509603 | 0.35 |
P27348 | 14-3-3 protein theta (14-3-3 protein T-cell) (14-3-3 protein tau) (Protein HS1) | EBI-25509603 | 0.35 |
O95347 | Structural maintenance of chromosomes protein 2 (SMC protein 2) (SMC-2) (Chromosome-associated protein E) (hCAP-E) (XCAP-E homolog) | EBI-25509603 | 0.35 |
P47756 | F-actin-capping protein subunit beta (CapZ beta) | EBI-25509603 | 0.35 |
Q13200 | 26S proteasome non-ATPase regulatory subunit 2 (26S proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) (Protein 55.11) (Tumor necrosis factor type 1 receptor-associated protein 2) | EBI-25509603 | 0.35 |
P52907 | F-actin-capping protein subunit alpha-1 (CapZ alpha-1) | EBI-25509603 | 0.35 |
Q9ULV4 | Coronin-1C (Coronin-3) (hCRNN4) | EBI-25509603 | 0.35 |
P62140 | Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PP-1B) (PPP1CD) (EC 3.1.3.16) (EC 3.1.3.53) | EBI-25509603 | 0.35 |
Q9NYL9 | Tropomodulin-3 (Ubiquitous tropomodulin) (U-Tmod) | EBI-25509603 | 0.35 |
P09622 | Dihydrolipoyl dehydrogenase, mitochondrial (EC 1.8.1.4) (Dihydrolipoamide dehydrogenase) (Glycine cleavage system L protein) | EBI-25509603 | 0.35 |
P00338 | L-lactate dehydrogenase A chain (LDH-A) (EC 1.1.1.27) (Cell proliferation-inducing gene 19 protein) (LDH muscle subunit) (LDH-M) (Renal carcinoma antigen NY-REN-59) | EBI-25509603 | 0.35 |
P11586 | C-1-tetrahydrofolate synthase, cytoplasmic (C1-THF synthase) (Epididymis secretory sperm binding protein) [Cleaved into: C-1-tetrahydrofolate synthase, cytoplasmic, N-terminally processed] [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9); Formyltetrahydrofolate synthetase (EC 6.3.4.3)] | EBI-25509669 | 0.53 |
Q07021 | Complement component 1 Q subcomponent-binding protein, mitochondrial (ASF/SF2-associated protein p32) (Glycoprotein gC1qBP) (C1qBP) (Hyaluronan-binding protein 1) (Mitochondrial matrix protein p32) (gC1q-R protein) (p33) (SF2AP32) | EBI-25509669 | 0.35 |
Q14315 | Filamin-C (FLN-C) (FLNc) (ABP-280-like protein) (ABP-L) (Actin-binding-like protein) (Filamin-2) (Gamma-filamin) | EBI-25509687 | 0.35 |
Q16576 | Histone-binding protein RBBP7 (Histone acetyltransferase type B subunit 2) (Nucleosome-remodeling factor subunit RBAP46) (Retinoblastoma-binding protein 7) (RBBP-7) (Retinoblastoma-binding protein p46) | EBI-25509687 | 0.35 |
O00148 | ATP-dependent RNA helicase DDX39A (EC 3.6.4.13) (DEAD box protein 39) (Nuclear RNA helicase URH49) | EBI-25509687 | 0.35 |
Q15366 | Poly(rC)-binding protein 2 (Alpha-CP2) (Heterogeneous nuclear ribonucleoprotein E2) (hnRNP E2) | EBI-25509687 | 0.35 |
Q15942 | Zyxin (Zyxin-2) | EBI-25509687 | 0.35 |
Q92945 | Far upstream element-binding protein 2 (FUSE-binding protein 2) (KH type-splicing regulatory protein) (KSRP) (p75) | EBI-25509687 | 0.35 |
Q99615 | DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) | EBI-25509687 | 0.35 |
P51570 | Galactokinase (EC 2.7.1.6) (Galactose kinase) | EBI-25509687 | 0.35 |
P67936 | Tropomyosin alpha-4 chain (TM30p1) (Tropomyosin-4) | EBI-25509687 | 0.35 |
Q9NRN7 | L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (EC 2.7.8.7) (4'-phosphopantetheinyl transferase) (Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase) (AASD-PPT) (LYS5 ortholog) | EBI-25509687 | 0.35 |
P25789 | Proteasome subunit alpha type-4 (Macropain subunit C9) (Multicatalytic endopeptidase complex subunit C9) (Proteasome component C9) (Proteasome subunit L) | EBI-25509767 | 0.35 |
P08621 | U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70 kDa) (U1-70K) (snRNP70) | EBI-25509767 | 0.35 |
P50990 | T-complex protein 1 subunit theta (TCP-1-theta) (CCT-theta) (Chaperonin containing T-complex polypeptide 1 subunit 8) (Renal carcinoma antigen NY-REN-15) | EBI-25509767 | 0.35 |
P06753 | Tropomyosin alpha-3 chain (Gamma-tropomyosin) (Tropomyosin-3) (Tropomyosin-5) (hTM5) | EBI-25509767 | 0.35 |
Q5JWF2 | Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas (Adenylate cyclase-stimulating G alpha protein) (Extra large alphas protein) (XLalphas) | EBI-25509767 | 0.35 |
P49368 | T-complex protein 1 subunit gamma (TCP-1-gamma) (CCT-gamma) (hTRiC5) | EBI-25509811 | 0.35 |
O75688 | Protein phosphatase 1B (EC 3.1.3.16) (Protein phosphatase 2C isoform beta) (PP2C-beta) | EBI-25509811 | 0.35 |
P04075 | Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Lung cancer antigen NY-LU-1) (Muscle-type aldolase) | EBI-25509811 | 0.35 |
Q15365 | Poly(rC)-binding protein 1 (Alpha-CP1) (Heterogeneous nuclear ribonucleoprotein E1) (hnRNP E1) (Nucleic acid-binding protein SUB2.3) | EBI-25509845 | 0.35 |
P17987 | T-complex protein 1 subunit alpha (TCP-1-alpha) (CCT-alpha) | EBI-25509845 | 0.35 |
P46109 | Crk-like protein | EBI-25509845 | 0.35 |
P47755 | F-actin-capping protein subunit alpha-2 (CapZ alpha-2) | EBI-25509845 | 0.35 |
P13797 | Plastin-3 (T-plastin) | EBI-25509845 | 0.35 |
P49327 | Fatty acid synthase (EC 2.3.1.85) (Type I fatty acid synthase) [Includes: [Acyl-carrier-protein] S-acetyltransferase (EC 2.3.1.38); [Acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39); 3-oxoacyl-[acyl-carrier-protein] synthase (EC 2.3.1.41); 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100); 3-hydroxyacyl-[acyl-carrier-protein] dehydratase (EC 4.2.1.59); Enoyl-[acyl-carrier-protein] reductase (EC 1.3.1.39); Acyl-[acyl-carrier-protein] hydrolase (EC 3.1.2.14)] | EBI-25509845 | 0.35 |
P59998 | Actin-related protein 2/3 complex subunit 4 (Arp2/3 complex 20 kDa subunit) (p20-ARC) | EBI-25509845 | 0.35 |
Q9NWT1 | p21-activated protein kinase-interacting protein 1 (PAK/PLC-interacting protein 1) (hPIP1) (PAK1-interacting protein 1) (WD repeat-containing protein 84) | EBI-25509874 | 0.35 |
Q9H0D6 | 5'-3' exoribonuclease 2 (EC 3.1.13.-) (DHM1-like protein) (DHP protein) | EBI-25509874 | 0.35 |
Q01081 | Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit) | EBI-25509874 | 0.35 |
Q15024 | Exosome complex component RRP42 (Exosome component 7) (Ribosomal RNA-processing protein 42) (p8) | EBI-25509874 | 0.35 |
Q9Y383 | Putative RNA-binding protein Luc7-like 2 | EBI-25509874 | 0.35 |
P62263 | 40S ribosomal protein S14 (Small ribosomal subunit protein uS11) | EBI-25509874 | 0.35 |
Q96SB4 | SRSF protein kinase 1 (EC 2.7.11.1) (SFRS protein kinase 1) (Serine/arginine-rich protein-specific kinase 1) (SR-protein-specific kinase 1) | EBI-25509874 | 0.35 |
P46087 | Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase (EC 2.1.1.-) (Nucleolar protein 1) (Nucleolar protein 2 homolog) (Proliferating-cell nucleolar antigen p120) (Proliferation-associated nucleolar protein p120) | EBI-25509874 | 0.35 |
P08708 | 40S ribosomal protein S17 (Small ribosomal subunit protein eS17) | EBI-25509874 | 0.35 |
P42285 | Exosome RNA helicase MTR4 (EC 3.6.4.13) (ATP-dependent RNA helicase DOB1) (ATP-dependent RNA helicase SKIV2L2) (Superkiller viralicidic activity 2-like 2) (TRAMP-like complex helicase) | EBI-25509874 | 0.35 |
Q99848 | Probable rRNA-processing protein EBP2 (EBNA1-binding protein 2) (Nucleolar protein p40) | EBI-25509874 | 0.35 |
Q12789 | General transcription factor 3C polypeptide 1 (TF3C-alpha) (TFIIIC box B-binding subunit) (Transcription factor IIIC 220 kDa subunit) (TFIIIC 220 kDa subunit) (TFIIIC220) (Transcription factor IIIC subunit alpha) | EBI-25509874 | 0.35 |
Q9P015 | 39S ribosomal protein L15, mitochondrial (L15mt) (MRP-L15) (Mitochondrial large ribosomal subunit protein uL15m) | EBI-25509874 | 0.35 |
Q13243 | Serine/arginine-rich splicing factor 5 (Delayed-early protein HRS) (Pre-mRNA-splicing factor SRP40) (Splicing factor, arginine/serine-rich 5) | EBI-25509874 | 0.35 |
Q1KMD3 | Heterogeneous nuclear ribonucleoprotein U-like protein 2 (Scaffold-attachment factor A2) (SAF-A2) | EBI-25509874 | 0.35 |
O60293 | Zinc finger C3H1 domain-containing protein (Coiled-coil domain-containing protein 131) (Proline/serine-rich coiled-coil protein 2) | EBI-25509874 | 0.35 |
O60832 | H/ACA ribonucleoprotein complex subunit DKC1 (EC 5.4.99.-) (CBF5 homolog) (Dyskerin) (Nopp140-associated protein of 57 kDa) (Nucleolar protein NAP57) (Nucleolar protein family A member 4) (snoRNP protein DKC1) | EBI-25509874 | 0.35 |
Q2NL82 | Pre-rRNA-processing protein TSR1 homolog | EBI-25509874 | 0.35 |
Q8N9T8 | Protein KRI1 homolog | EBI-25509874 | 0.35 |
Q15020 | Squamous cell carcinoma antigen recognized by T-cells 3 (SART-3) (Tat-interacting protein of 110 kDa) (Tip110) (p110 nuclear RNA-binding protein) | EBI-25509874 | 0.35 |
O75934 | Pre-mRNA-splicing factor SPF27 (Breast carcinoma-amplified sequence 2) (DNA amplified in mammary carcinoma 1 protein) (Spliceosome-associated protein SPF 27) | EBI-25509874 | 0.35 |
Q5SSJ5 | Heterochromatin protein 1-binding protein 3 (Protein HP1-BP74) | EBI-25509874 | 0.35 |
Q14137 | Ribosome biogenesis protein BOP1 (Block of proliferation 1 protein) | EBI-25509874 | 0.35 |
Q92974 | Rho guanine nucleotide exchange factor 2 (Guanine nucleotide exchange factor H1) (GEF-H1) (Microtubule-regulated Rho-GEF) (Proliferating cell nucleolar antigen p40) | EBI-25509874 | 0.35 |
Q8IY21 | Probable ATP-dependent RNA helicase DDX60 (EC 3.6.4.13) (DEAD box protein 60) | EBI-26495688 | 0.40 |
P54132 | RecQ-like DNA helicase BLM (EC 3.6.4.12) (Bloom syndrome protein) (DNA helicase, RecQ-like type 2) (RecQ2) (RecQ protein-like 3) | EBI-26495696 | 0.35 |
Q9BVQ7 | Ribosome biogenesis protein SPATA5L1 (EC 3.6.4.10) (Spermatogenesis-associated protein 5-like protein 1) | EBI-26495696 | 0.35 |
Q14146 | Unhealthy ribosome biogenesis protein 2 homolog | EBI-26495696 | 0.35 |
Q6P1X5 | Transcription initiation factor TFIID subunit 2 (150 kDa cofactor of initiator function) (RNA polymerase II TBP-associated factor subunit B) (TBP-associated factor 150 kDa) (Transcription initiation factor TFIID 150 kDa subunit) (TAF(II)150) (TAFII-150) (TAFII150) | EBI-26495696 | 0.35 |
Q13427 | Peptidyl-prolyl cis-trans isomerase G (PPIase G) (Peptidyl-prolyl isomerase G) (EC 5.2.1.8) (CASP10) (Clk-associating RS-cyclophilin) (CARS-Cyp) (CARS-cyclophilin) (SR-cyclophilin) (SR-cyp) (SRcyp) (Cyclophilin G) (Rotamase G) | EBI-26495696 | 0.35 |
P19878 | Neutrophil cytosol factor 2 (NCF-2) (67 kDa neutrophil oxidase factor) (NADPH oxidase activator 2) (Neutrophil NADPH oxidase factor 2) (p67-phox) | EBI-26495696 | 0.35 |
Q9NYV4 | Cyclin-dependent kinase 12 (EC 2.7.11.22) (EC 2.7.11.23) (Cdc2-related kinase, arginine/serine-rich) (CrkRS) (Cell division cycle 2-related protein kinase 7) (CDC2-related protein kinase 7) (Cell division protein kinase 12) (hCDK12) | EBI-26495696 | 0.35 |
Q12873 | Chromodomain-helicase-DNA-binding protein 3 (CHD-3) (EC 3.6.4.12) (ATP-dependent helicase CHD3) (Mi-2 autoantigen 240 kDa protein) (Mi2-alpha) (Zinc finger helicase) (hZFH) | EBI-26495696 | 0.35 |
P30414 | NK-tumor recognition protein (NK-TR protein) (Natural-killer cells cyclophilin-related protein) (Peptidyl-prolyl cis-trans isomerase NKTR) (PPIase) (EC 5.2.1.8) (Rotamase) | EBI-26495696 | 0.35 |
Q9BRT6 | Protein LLP homolog (Protein LAPS18-like) | EBI-26495696 | 0.35 |
Q8IZ69 | tRNA (uracil-5-)-methyltransferase homolog A (EC 2.1.1.35) (mRNA (uracil-5-)-methyltransferase TRMT2A) (EC 2.1.1.-) | EBI-26495696 | 0.35 |
O60287 | Nucleolar pre-ribosomal-associated protein 1 (Nucleolar protein 254 kDa) (URB1 ribosome biogenesis 1 homolog) | EBI-26495696 | 0.35 |
Q8N4N8 | Kinesin-like protein KIF2B | EBI-26495696 | 0.35 |
Q9GZR2 | RNA exonuclease 4 (EC 3.1.-.-) (Exonuclease XPMC2) (Prevents mitotic catastrophe 2 protein homolog) (hPMC2) | EBI-26495696 | 0.35 |
Q14241 | Elongin-A (EloA) (Elongin 110 kDa subunit) (RNA polymerase II transcription factor SIII subunit A1) (SIII p110) (Transcription elongation factor B polypeptide 3) | EBI-26495696 | 0.35 |
P49711 | Transcriptional repressor CTCF (11-zinc finger protein) (CCCTC-binding factor) (CTCFL paralog) | EBI-26495696 | 0.35 |
Q8N3C0 | Activating signal cointegrator 1 complex subunit 3 (EC 3.6.4.12) (ASC-1 complex subunit p200) (ASC1p200) (Helicase, ATP binding 1) (Trip4 complex subunit p200) | EBI-26495696 | 0.35 |
Q9UPE1 | SRSF protein kinase 3 (EC 2.7.11.1) (Muscle-specific serine kinase 1) (MSSK-1) (Serine/arginine-rich protein-specific kinase 3) (SR-protein-specific kinase 3) (Serine/threonine-protein kinase 23) | EBI-26495696 | 0.35 |
Q9H9Y6 | DNA-directed RNA polymerase I subunit RPA2 (RNA polymerase I subunit 2) (EC 2.7.7.6) (DNA-directed RNA polymerase I 135 kDa polypeptide) (RPA135) | EBI-26495696 | 0.35 |
P20042 | Eukaryotic translation initiation factor 2 subunit 2 (Eukaryotic translation initiation factor 2 subunit beta) (eIF-2-beta) | EBI-26495696 | 0.35 |
Q49A26 | Cytokine-like nuclear factor N-PAC (NPAC) (3-hydroxyisobutyrate dehydrogenase-like protein) (Glyoxylate reductase 1 homolog) (Nuclear protein NP60) (Nuclear protein of 60 kDa) (Nucleosome-destabilizing factor) (hNDF) (Putative oxidoreductase GLYR1) | EBI-26495696 | 0.35 |
Q8NFW8 | N-acylneuraminate cytidylyltransferase (EC 2.7.7.43) (CMP-N-acetylneuraminic acid synthase) (CMP-NeuNAc synthase) | EBI-26495696 | 0.35 |
Q15397 | Pumilio homolog 3 (HBV X-transactivated gene 5 protein) (HBV XAg-transactivated protein 5) (Minor histocompatibility antigen HA-8) (HLA-HA8) | EBI-26495696 | 0.35 |
Q9Y6C9 | Mitochondrial carrier homolog 2 (Met-induced mitochondrial protein) | EBI-26495704 | 0.35 |
P20674 | Cytochrome c oxidase subunit 5A, mitochondrial (Cytochrome c oxidase polypeptide Va) | EBI-26495704 | 0.35 |
Q9BVT8 | Transmembrane and ubiquitin-like domain-containing protein 1 (Dendritic cell-derived ubiquitin-like protein) (DULP) (Hepatocyte odd protein shuttling protein) (Ubiquitin-like protein SB144) [Cleaved into: iHOPS] | EBI-26495704 | 0.35 |
P10606 | Cytochrome c oxidase subunit 5B, mitochondrial (Cytochrome c oxidase polypeptide Vb) | EBI-26495704 | 0.35 |
P28331 | NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial (EC 7.1.1.2) (Complex I-75kD) (CI-75kD) | EBI-26495704 | 0.35 |
P85037 | Forkhead box protein K1 (Myocyte nuclear factor) (MNF) | EBI-26495704 | 0.35 |
P13073 | Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (Cytochrome c oxidase polypeptide IV) (Cytochrome c oxidase subunit IV isoform 1) (COX IV-1) | EBI-26495704 | 0.35 |
Q9UJZ1 | Stomatin-like protein 2, mitochondrial (SLP-2) (EPB72-like protein 2) (Paraprotein target 7) (Paratarg-7) | EBI-26495704 | 0.35 |
Q01831 | DNA repair protein complementing XP-C cells (Xeroderma pigmentosum group C-complementing protein) (p125) | EBI-26495709 | 0.35 |
P54725 | UV excision repair protein RAD23 homolog A (HR23A) (hHR23A) | EBI-26495709 | 0.35 |
Q14232 | Translation initiation factor eIF-2B subunit alpha (eIF-2B GDP-GTP exchange factor subunit alpha) | EBI-26495714 | 0.35 |
Q9P0M6 | Core histone macro-H2A.2 (Histone macroH2A2) (mH2A2) | EBI-26495714 | 0.35 |
Q8IYD1 | Eukaryotic peptide chain release factor GTP-binding subunit ERF3B (Eukaryotic peptide chain release factor subunit 3b) (eRF3b) (G1 to S phase transition protein 2 homolog) | EBI-26495747 | 0.35 |
P49588 | Alanine--tRNA ligase, cytoplasmic (EC 6.1.1.7) (Alanyl-tRNA synthetase) (AlaRS) (Renal carcinoma antigen NY-REN-42) | EBI-26495747 | 0.35 |
Q9UJV3 | Probable E3 ubiquitin-protein ligase MID2 (EC 2.3.2.27) (Midin-2) (Midline defect 2) (Midline-2) (RING finger protein 60) (RING-type E3 ubiquitin transferase MID2) (Tripartite motif-containing protein 1) | EBI-26495747 | 0.35 |
P52701 | DNA mismatch repair protein Msh6 (hMSH6) (G/T mismatch-binding protein) (GTBP) (GTMBP) (MutS protein homolog 6) (MutS-alpha 160 kDa subunit) (p160) | EBI-26495747 | 0.35 |
Q86X55 | Histone-arginine methyltransferase CARM1 (EC 2.1.1.319) (Coactivator-associated arginine methyltransferase 1) (Protein arginine N-methyltransferase 4) | EBI-26495747 | 0.35 |
Q8WU90 | Zinc finger CCCH domain-containing protein 15 (DRG family-regulatory protein 1) (Likely ortholog of mouse immediate early response erythropoietin 4) | EBI-26495747 | 0.35 |
Q9NPF4 | tRNA N6-adenosine threonylcarbamoyltransferase (EC 2.3.1.234) (N6-L-threonylcarbamoyladenine synthase) (t(6)A synthase) (O-sialoglycoprotein endopeptidase) (hOSGEP) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein OSGEP) (tRNA threonylcarbamoyladenosine biosynthesis protein OSGEP) | EBI-26495747 | 0.35 |
O43837 | Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial (Isocitric dehydrogenase subunit beta) (NAD(+)-specific ICDH subunit beta) | EBI-26495747 | 0.35 |
Q15654 | Thyroid receptor-interacting protein 6 (TR-interacting protein 6) (TRIP-6) (Opa-interacting protein 1) (OIP-1) (Zyxin-related protein 1) (ZRP-1) | EBI-26495747 | 0.35 |
P28340 | DNA polymerase delta catalytic subunit (EC 2.7.7.7) (3'-5' exodeoxyribonuclease) (EC 3.1.11.-) (DNA polymerase subunit delta p125) | EBI-26495747 | 0.35 |
P04183 | Thymidine kinase, cytosolic (EC 2.7.1.21) | EBI-26495747 | 0.35 |
Q96D46 | 60S ribosomal export protein NMD3 (hNMD3) | EBI-26495747 | 0.35 |
O60518 | Ran-binding protein 6 (RanBP6) | EBI-26495747 | 0.35 |
Q9BW92 | Threonine--tRNA ligase, mitochondrial (EC 6.1.1.3) (Threonyl-tRNA synthetase) (ThrRS) (Threonyl-tRNA synthetase-like 1) | EBI-26495747 | 0.35 |
Q9UGI8 | Testin (TESS) | EBI-26495747 | 0.35 |
P52790 | Hexokinase-3 (EC 2.7.1.1) (Hexokinase type III) (HK III) (Hexokinase-C) | EBI-26495747 | 0.35 |
Q9BRX2 | Protein pelota homolog (EC 3.1.-.-) | EBI-26495747 | 0.35 |
Q9Y2L1 | Exosome complex exonuclease RRP44 (EC 3.1.13.-) (EC 3.1.26.-) (Protein DIS3 homolog) (Ribosomal RNA-processing protein 44) | EBI-26495747 | 0.35 |
Q9HAV4 | Exportin-5 (Exp5) (Ran-binding protein 21) | EBI-26495747 | 0.35 |
Q86VP6 | Cullin-associated NEDD8-dissociated protein 1 (Cullin-associated and neddylation-dissociated protein 1) (TBP-interacting protein of 120 kDa A) (TBP-interacting protein 120A) (p120 CAND1) | EBI-26495747 | 0.35 |
P49419 | Alpha-aminoadipic semialdehyde dehydrogenase (Alpha-AASA dehydrogenase) (EC 1.2.1.31) (Aldehyde dehydrogenase family 7 member A1) (EC 1.2.1.3) (Antiquitin-1) (Betaine aldehyde dehydrogenase) (EC 1.2.1.8) (Delta1-piperideine-6-carboxylate dehydrogenase) (P6c dehydrogenase) | EBI-26495747 | 0.35 |
P54886 | Delta-1-pyrroline-5-carboxylate synthase (P5CS) (Aldehyde dehydrogenase family 18 member A1) [Includes: Glutamate 5-kinase (GK) (EC 2.7.2.11) (Gamma-glutamyl kinase); Gamma-glutamyl phosphate reductase (GPR) (EC 1.2.1.41) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase)] | EBI-26495747 | 0.35 |
P62633 | CCHC-type zinc finger nucleic acid binding protein (Cellular nucleic acid-binding protein) (CNBP) (Zinc finger protein 9) | EBI-26495753 | 0.35 |
P35237 | Serpin B6 (Cytoplasmic antiproteinase) (CAP) (Peptidase inhibitor 6) (PI-6) (Placental thrombin inhibitor) | EBI-26495753 | 0.35 |
P30044 | Peroxiredoxin-5, mitochondrial (EC 1.11.1.24) (Alu corepressor 1) (Antioxidant enzyme B166) (AOEB166) (Liver tissue 2D-page spot 71B) (PLP) (Peroxiredoxin V) (Prx-V) (Peroxisomal antioxidant enzyme) (TPx type VI) (Thioredoxin peroxidase PMP20) (Thioredoxin-dependent peroxiredoxin 5) | EBI-26495753 | 0.35 |
Q9NYU2 | UDP-glucose:glycoprotein glucosyltransferase 1 (UGT1) (hUGT1) (EC 2.4.1.-) (UDP--Glc:glycoprotein glucosyltransferase) (UDP-glucose ceramide glucosyltransferase-like 1) | EBI-26495753 | 0.35 |
Q9Y2T4 | Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform (IMYPNO1) (PP2A subunit B isoform B55-gamma) (PP2A subunit B isoform PR55-gamma) (PP2A subunit B isoform R2-gamma) (PP2A subunit B isoform gamma) | EBI-26495753 | 0.35 |
Q13162 | Peroxiredoxin-4 (EC 1.11.1.24) (Antioxidant enzyme AOE372) (AOE37-2) (Peroxiredoxin IV) (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Thioredoxin-dependent peroxiredoxin 4) | EBI-26495753 | 0.35 |
O60826 | Coiled-coil domain-containing protein 22 | EBI-26495758 | 0.67 |
P13489 | Ribonuclease inhibitor (Placental ribonuclease inhibitor) (Placental RNase inhibitor) (Ribonuclease/angiogenin inhibitor 1) (RAI) | EBI-26495758 | 0.35 |
O15269 | Serine palmitoyltransferase 1 (EC 2.3.1.50) (Long chain base biosynthesis protein 1) (LCB 1) (Serine-palmitoyl-CoA transferase 1) (SPT 1) (SPT1) | EBI-26495763 | 0.35 |
P43686 | 26S proteasome regulatory subunit 6B (26S proteasome AAA-ATPase subunit RPT3) (MB67-interacting protein) (MIP224) (Proteasome 26S subunit ATPase 4) (Tat-binding protein 7) (TBP-7) | EBI-26495763 | 0.35 |
Q99623 | Prohibitin-2 (B-cell receptor-associated protein BAP37) (D-prohibitin) (Repressor of estrogen receptor activity) | EBI-26495763 | 0.53 |
P35232 | Prohibitin 1 | EBI-26495763 | 0.35 |
Q9UBV2 | Protein sel-1 homolog 1 (Suppressor of lin-12-like protein 1) (Sel-1L) | EBI-26495763 | 0.35 |
P04844 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit) (RIBIIR) (Ribophorin II) (RPN-II) (Ribophorin-2) | EBI-26495763 | 0.35 |
O15260 | Surfeit locus protein 4 | EBI-26495763 | 0.35 |
O75947 | ATP synthase subunit d, mitochondrial (ATPase subunit d) (ATP synthase peripheral stalk subunit d) | EBI-25686067 | 0.53 |
O94905 | Erlin-2 (Endoplasmic reticulum lipid raft-associated protein 2) (Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2) (SPFH domain-containing protein 2) | EBI-26495763 | 0.35 |
Q9Y277 | Voltage-dependent anion-selective channel protein 3 (VDAC-3) (hVDAC3) (Outer mitochondrial membrane protein porin 3) | EBI-26495763 | 0.35 |
P24539 | ATP synthase F(0) complex subunit B1, mitochondrial (ATP synthase peripheral stalk-membrane subunit b) (ATP synthase proton-transporting mitochondrial F(0) complex subunit B1) (ATP synthase subunit b) (ATPase subunit b) | EBI-25686067 | 0.53 |
Q96DZ1 | Endoplasmic reticulum lectin 1 (ER lectin) (Erlectin) (XTP3-transactivated gene B protein) | EBI-26495763 | 0.35 |
P27824 | Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90) | EBI-26495763 | 0.35 |
P36542 | ATP synthase subunit gamma, mitochondrial (ATP synthase F1 subunit gamma) (F-ATPase gamma subunit) | EBI-26495763 | 0.35 |
P48047 | ATP synthase subunit O, mitochondrial (ATP synthase peripheral stalk subunit OSCP) (Oligomycin sensitivity conferral protein) (OSCP) | EBI-26495763 | 0.35 |
P21796 | Voltage-dependent anion-selective channel protein 1 (VDAC-1) (hVDAC1) (Outer mitochondrial membrane protein porin 1) (Plasmalemmal porin) (Porin 31HL) (Porin 31HM) | EBI-26495763 | 0.35 |
P45880 | Voltage-dependent anion-selective channel protein 2 (VDAC-2) (hVDAC2) (Outer mitochondrial membrane protein porin 2) | EBI-26495763 | 0.35 |
P17480 | Nucleolar transcription factor 1 (Autoantigen NOR-90) (Upstream-binding factor 1) (UBF-1) | EBI-26495768 | 0.35 |
Q9NVI1 | Fanconi anemia group I protein (Protein FACI) | EBI-26495768 | 0.35 |
Q9Y4B6 | DDB1- and CUL4-associated factor 1 (HIV-1 Vpr-binding protein) (VprBP) (Serine/threonine-protein kinase VPRBP) (EC 2.7.11.1) (Vpr-interacting protein) | EBI-26495768 | 0.35 |
Q9H000 | E3 ubiquitin-protein ligase makorin-2 (EC 2.3.2.27) (RING finger protein 62) (RING-type E3 ubiquitin transferase makorin-2) | EBI-26495768 | 0.67 |
P07205 | Phosphoglycerate kinase 2 (EC 2.7.2.3) (Phosphoglycerate kinase, testis specific) | EBI-26495768 | 0.35 |
Q96PM5 | RING finger and CHY zinc finger domain-containing protein 1 (EC 2.3.2.27) (Androgen receptor N-terminal-interacting protein) (CH-rich-interacting match with PLAG1) (E3 ubiquitin-protein ligase Pirh2) (RING finger protein 199) (RING-type E3 ubiquitin transferase RCHY1) (Zinc finger protein 363) (p53-induced RING-H2 protein) (hPirh2) | EBI-26495768 | 0.35 |
P51116 | RNA-binding protein FXR2 (FMR1 autosomal homolog 2) | EBI-26495768 | 0.67 |
P51114 | RNA-binding protein FXR1 (FMR1 autosomal homolog 1) (hFXR1p) | EBI-26495768 | 0.74 |
P22061 | Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PIMT) (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl/D-aspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) | EBI-26495773 | 0.56 |
Q96EY7 | Pentatricopeptide repeat domain-containing protein 3, mitochondrial (28S ribosomal protein S39, mitochondrial) (MRP-S39) (Mitochondrial small ribosomal subunit protein mS39) (Transformation-related gene 15 protein) (TRG-15) | EBI-26495783 | 0.35 |
Q9BXT6 | RNA helicase Mov10l1 (EC 3.6.4.13) (Moloney leukemia virus 10-like protein 1) (MOV10-like protein 1) | EBI-26495783 | 0.35 |
Q8TC07 | TBC1 domain family member 15 (GTPase-activating protein RAB7) (GAP for RAB7) (Rab7-GAP) | EBI-26496082 | 0.35 |
Q92614 | Unconventional myosin-XVIIIa (Molecule associated with JAK3 N-terminus) (MAJN) (Myosin containing a PDZ domain) (Surfactant protein receptor SP-R210) (SP-R210) | EBI-26496082 | 0.35 |
A6NEC2 | Puromycin-sensitive aminopeptidase-like protein (EC 3.4.11.-) | EBI-26496082 | 0.35 |
P55060 | Exportin-2 (Exp2) (Cellular apoptosis susceptibility protein) (Chromosome segregation 1-like protein) (Importin-alpha re-exporter) | EBI-26496082 | 0.35 |
P53618 | Coatomer subunit beta (Beta-coat protein) (Beta-COP) | EBI-26496082 | 0.35 |
Q5T160 | Probable arginine--tRNA ligase, mitochondrial (EC 6.1.1.19) (Arginyl-tRNA synthetase) (ArgRS) | EBI-26496082 | 0.35 |
Q15751 | Probable E3 ubiquitin-protein ligase HERC1 (EC 2.3.2.26) (HECT domain and RCC1-like domain-containing protein 1) (HECT-type E3 ubiquitin transferase HERC1) (p532) (p619) | EBI-26496082 | 0.53 |
Q14573 | Inositol 1,4,5-trisphosphate receptor type 3 (IP3 receptor isoform 3) (IP3R 3) (InsP3R3) (Type 3 inositol 1,4,5-trisphosphate receptor) (Type 3 InsP3 receptor) | EBI-26496082 | 0.35 |
Q92616 | eIF-2-alpha kinase activator GCN1 (GCN1 eIF-2-alpha kinase activator homolog) (GCN1-like protein 1) (General control of amino-acid synthesis 1-like protein 1) (Translational activator GCN1) (HsGCN1) | EBI-26496082 | 0.35 |
Q53GL7 | Protein mono-ADP-ribosyltransferase PARP10 (EC 2.4.2.-) (ADP-ribosyltransferase diphtheria toxin-like 10) (ARTD10) (Poly [ADP-ribose] polymerase 10) (PARP-10) | EBI-25619194 | 0.44 |
Q9H3R2 | Mucin-13 (MUC-13) (Down-regulated in colon cancer 1) | EBI-25686027 | 0.35 |
O60524 | Ribosome quality control complex subunit NEMF (Antigen NY-CO-1) (Nuclear export mediator factor) (Serologically defined colon cancer antigen 1) | EBI-25686027 | 0.35 |
Q86TG7 | Retrotransposon-derived protein PEG10 (Embryonal carcinoma differentiation-regulated protein) (Mammalian retrotransposon-derived protein 2) (Myelin expression factor 3-like protein 1) (MEF3-like protein 1) (Paternally expressed gene 10 protein) (Retrotransposon gag domain-containing protein 3) (Retrotransposon-derived gag-like polyprotein) (Ty3/Gypsy-like protein) | EBI-25686016 | 0.35 |
P15622 | Zinc finger protein 250 (Zinc finger protein 647) | EBI-25686016 | 0.35 |
O76064 | E3 ubiquitin-protein ligase RNF8 (hRNF8) (EC 2.3.2.27) (RING finger protein 8) (RING-type E3 ubiquitin transferase RNF8) | EBI-25686007 | 0.40 |
O00238 | Bone morphogenetic protein receptor type-1B (BMP type-1B receptor) (BMPR-1B) (EC 2.7.11.30) (CD antigen CDw293) | EBI-25686038 | 0.35 |
Q9UHN6 | Cell surface hyaluronidase (EC 3.2.1.35) (Cell migration-inducing hyaluronidase 2) (Transmembrane protein 2) | EBI-25686038 | 0.35 |
Q969N2 | GPI transamidase component PIG-T (Phosphatidylinositol-glycan biosynthesis class T protein) | EBI-25686038 | 0.35 |
Q92820 | Gamma-glutamyl hydrolase (EC 3.4.19.9) (Conjugase) (GH) (Gamma-Glu-X carboxypeptidase) | EBI-25686038 | 0.35 |
Q6NUS6 | Tectonic-3 | EBI-25686038 | 0.35 |
Q30201 | Hereditary hemochromatosis protein (HLA-H) | EBI-25686038 | 0.35 |
Q16658 | Fascin (55 kDa actin-bundling protein) (Singed-like protein) (p55) | EBI-25686038 | 0.35 |
P51690 | Arylsulfatase L (EC 3.1.6.1) (Arylsulfatase E) (ASE) | EBI-25686038 | 0.35 |
P10321 | HLA class I histocompatibility antigen, C alpha chain (HLA-C) (HLA-Cw) (Human leukocyte antigen C) | EBI-25686038 | 0.35 |
P11021 | Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein) (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin heavy chain-binding protein) | EBI-25686038 | 0.35 |
O75354 | Ectonucleoside triphosphate diphosphohydrolase 6 (NTPDase 6) (EC 3.6.1.6) (CD39 antigen-like 2) | EBI-25686038 | 0.35 |
Q5VW36 | Focadhesin | EBI-25686238 | 0.35 |
P00846 | ATP synthase subunit a (F-ATPase protein 6) | EBI-25686067 | 0.35 |
O43264 | Centromere/kinetochore protein zw10 homolog | EBI-25686067 | 0.35 |
Q9UPQ8 | Dolichol kinase (EC 2.7.1.108) (Transmembrane protein 15) | EBI-25686067 | 0.35 |
Q96B96 | Lipid droplet assembly factor 1 (Promethin) (Transmembrane protein 159) | EBI-25686067 | 0.35 |
O94919 | Endonuclease domain-containing 1 protein (EC 3.1.30.-) | EBI-25686067 | 0.53 |
Q9Y5Z9 | UbiA prenyltransferase domain-containing protein 1 (EC 2.5.1.-) (Transitional epithelial response protein 1) | EBI-25686067 | 0.35 |
Q9Y561 | Low-density lipoprotein receptor-related protein 12 (LDLR-related protein 12) (LRP-12) (Suppressor of tumorigenicity 7 protein) | EBI-25686067 | 0.35 |
Q9Y3P4 | Rhomboid domain-containing protein 3 | EBI-25686067 | 0.35 |
Q9UBU6 | Protein FAM8A1 (Autosomal highly conserved protein) | EBI-25686067 | 0.35 |
Q9UBF2 | Coatomer subunit gamma-2 (Gamma-2-coat protein) (Gamma-2-COP) | EBI-25686067 | 0.35 |
Q9P0I2 | ER membrane protein complex subunit 3 (Transmembrane protein 111) | EBI-25686067 | 0.53 |
Q9NWS8 | Required for meiotic nuclear division protein 1 homolog | EBI-25686067 | 0.35 |
Q9NUT2 | Mitochondrial potassium channel ATP-binding subunit (ATP-binding cassette sub-family B member 8, mitochondrial) (ABCB8) (Mitochondrial ATP-binding cassette 1) (M-ABC1) (Mitochondrial sulfonylurea-receptor) (MITOSUR) | EBI-25686067 | 0.35 |
Q9H490 | Phosphatidylinositol glycan anchor biosynthesis class U protein (Cell division cycle protein 91-like 1) (Protein CDC91-like 1) (GPI transamidase component PIG-U) | EBI-25686067 | 0.35 |
Q9H2J7 | Sodium-dependent neutral amino acid transporter B(0)AT2 (Sodium- and chloride-dependent neurotransmitter transporter NTT73) (Sodium-coupled branched-chain amino-acid transporter 1) (Solute carrier family 6 member 15) (Transporter v7-3) | EBI-25686067 | 0.53 |
Q9C0H2 | Protein tweety homolog 3 (hTTY3) | EBI-25686067 | 0.35 |
Q9BVG9 | Phosphatidylserine synthase 2 (PSS-2) (PtdSer synthase 2) (EC 2.7.8.29) (Serine-exchange enzyme II) | EBI-25686067 | 0.35 |
Q9BT76 | Uroplakin-3b (UP3b) (Uroplakin IIIb) (UPIIIb) (p35) | EBI-25686067 | 0.35 |
Q9BSR8 | Protein YIPF4 (YIP1 family member 4) | EBI-25686067 | 0.35 |
Q9BRR6 | ADP-dependent glucokinase (ADP-GK) (ADPGK) (EC 2.7.1.147) (RbBP-35) | EBI-25686067 | 0.35 |
Q96S52 | GPI transamidase component PIG-S (Phosphatidylinositol-glycan biosynthesis class S protein) | EBI-25686067 | 0.35 |
Q96Q80 | Derlin-3 (Degradation in endoplasmic reticulum protein 3) (DERtrin-3) (Der1-like protein 3) | EBI-25686067 | 0.35 |
Q96HV5 | Transmembrane protein 41A | EBI-25686067 | 0.35 |
Q96GC9 | Vacuole membrane protein 1 (Transmembrane protein 49) | EBI-25686067 | 0.35 |
Q96G23 | Ceramide synthase 2 (CerS2) (LAG1 longevity assurance homolog 2) (SP260) (Sphingosine N-acyltransferase CERS2) (EC 2.3.1.24) (Tumor metastasis-suppressor gene 1 protein) (Very-long-chain ceramide synthase CERS2) (EC 2.3.1.297) | EBI-25686067 | 0.35 |
Q96ES6 | Major facilitator superfamily domain-containing protein 3 | EBI-25686067 | 0.35 |
Q96CP7 | TLC domain-containing protein 1 (Calfacilitin) | EBI-25686067 | 0.35 |
Q96C19 | EF-hand domain-containing protein D2 (Swiprosin-1) | EBI-25686067 | 0.35 |
Q969E2 | Secretory carrier-associated membrane protein 4 (Secretory carrier membrane protein 4) | EBI-25686067 | 0.35 |
Q92536 | Y+L amino acid transporter 2 (Cationic amino acid transporter, y+ system) (Solute carrier family 7 member 6) (y(+)L-type amino acid transporter 2) (Y+LAT2) (y+LAT-2) | EBI-25686067 | 0.35 |
Q8WY22 | BRI3-binding protein (I3-binding protein) (Cervical cancer 1 proto-oncogene-binding protein KG19) (HCCRBP-1) | EBI-25686067 | 0.35 |
Q8WVQ1 | Soluble calcium-activated nucleotidase 1 (SCAN-1) (EC 3.6.1.6) (Apyrase homolog) (Putative MAPK-activating protein PM09) (Putative NF-kappa-B-activating protein 107) | EBI-25686067 | 0.35 |
Q8WUD6 | Cholinephosphotransferase 1 (hCPT1) (EC 2.7.8.2) (AAPT1-like protein) (Diacylglycerol cholinephosphotransferase 1) | EBI-25686067 | 0.35 |
Q8WTW3 | Conserved oligomeric Golgi complex subunit 1 (COG complex subunit 1) (Component of oligomeric Golgi complex 1) | EBI-25686067 | 0.35 |
Q8N357 | Solute carrier family 35 member F6 (ANT2-binding protein) (ANT2BP) (Transport and Golgi organization 9 homolog) | EBI-25686067 | 0.35 |
Q8N0U8 | Vitamin K epoxide reductase complex subunit 1-like protein 1 (VKORC1-like protein 1) (EC 1.17.4.4) | EBI-25686067 | 0.35 |
Q7Z3C6 | Autophagy-related protein 9A (APG9-like 1) (mATG9) | EBI-25686067 | 0.35 |
Q6Y1H2 | Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 (EC 4.2.1.134) (3-hydroxyacyl-CoA dehydratase 2) (HACD2) (Protein-tyrosine phosphatase-like member B) | EBI-25686067 | 0.35 |
Q6SZW1 | NAD(+) hydrolase SARM1 (NADase SARM1) (hSARM1) (EC 3.2.2.6) (NADP(+) hydrolase SARM1) (EC 3.2.2.-) (Sterile alpha and Armadillo repeat protein) (Sterile alpha and TIR motif-containing protein 1) (Sterile alpha motif domain-containing protein 2) (MyD88-5) (SAM domain-containing protein 2) (Tir-1 homolog) (HsTIR) | EBI-25686067 | 0.53 |
Q6P1A2 | Lysophospholipid acyltransferase 5 (LPLAT 5) (EC 2.3.1.-) (1-acylglycerophosphocholine O-acyltransferase) (EC 2.3.1.23) (1-acylglycerophosphoethanolamine O-acyltransferase) (EC 2.3.1.n7) (1-acylglycerophosphoserine O-acyltransferase) (EC 2.3.1.n6) (Lysophosphatidylcholine acyltransferase) (LPCAT) (Lyso-PC acyltransferase) (Lysophosphatidylcholine acyltransferase 3) (Lyso-PC acyltransferase 3) (Lysophosphatidylserine acyltransferase) (LPSAT) (Lyso-PS acyltransferase) (Membrane-bound O-acyltransferase domain-containing protein 5) (O-acyltransferase domain-containing protein 5) | EBI-25686067 | 0.35 |
Q5UCC4 | ER membrane protein complex subunit 10 (Hematopoietic signal peptide-containing membrane domain-containing protein 1) | EBI-25686067 | 0.35 |
Q5J8M3 | ER membrane protein complex subunit 4 (Cell proliferation-inducing gene 17 protein) (Transmembrane protein 85) | EBI-25686067 | 0.53 |
Q5HYI8 | Rab-like protein 3 | EBI-25686067 | 0.35 |
Q5BJH7 | Protein YIF1B (YIP1-interacting factor homolog B) | EBI-25686067 | 0.35 |
Q15800 | Methylsterol monooxygenase 1 (EC 1.14.18.9) (C-4 methylsterol oxidase) (Sterol-C4-methyl oxidase) | EBI-25686067 | 0.35 |
Q15392 | Delta(24)-sterol reductase (EC 1.3.1.72) (24-dehydrocholesterol reductase) (3-beta-hydroxysterol Delta-24-reductase) (Diminuto/dwarf1 homolog) (Seladin-1) | EBI-25686067 | 0.35 |
Q15043 | Metal cation symporter ZIP14 (LIV-1 subfamily of ZIP zinc transporter 4) (LZT-Hs4) (Solute carrier family 39 member 14) (Zrt- and Irt-like protein 14) (ZIP-14) | EBI-25686067 | 0.35 |
Q15006 | ER membrane protein complex subunit 2 (Tetratricopeptide repeat protein 35) (TPR repeat protein 35) | EBI-25686067 | 0.35 |
Q14746 | Conserved oligomeric Golgi complex subunit 2 (COG complex subunit 2) (Component of oligomeric Golgi complex 2) (Low density lipoprotein receptor defect C-complementing protein) | EBI-25686067 | 0.35 |
Q14596 | Next to BRCA1 gene 1 protein (Cell migration-inducing gene 19 protein) (Membrane component chromosome 17 surface marker 2) (Neighbor of BRCA1 gene 1 protein) (Protein 1A1-3B) | EBI-25686067 | 0.35 |
Q14019 | Coactosin-like protein | EBI-25686067 | 0.35 |
Q13637 | Ras-related protein Rab-32 | EBI-25686067 | 0.35 |
Q03135 | Caveolin-1 | EBI-25686067 | 0.53 |
P83436 | Conserved oligomeric Golgi complex subunit 7 (COG complex subunit 7) (Component of oligomeric Golgi complex 7) | EBI-25686067 | 0.35 |
P58658 | Protein eva-1 homolog C (Protein FAM176C) (SUE21) | EBI-25686067 | 0.35 |
P56381 | ATP synthase subunit epsilon, mitochondrial (ATPase subunit epsilon) (ATP synthase F1 subunit epsilon) | EBI-25686067 | 0.35 |
P51636 | Caveolin-2 | EBI-25686067 | 0.35 |
P30049 | ATP synthase subunit delta, mitochondrial (ATP synthase F1 subunit delta) (F-ATPase delta subunit) | EBI-25686067 | 0.53 |
P28328 | Peroxisome biogenesis factor 2 (35 kDa peroxisomal membrane protein) (Peroxin-2) (Peroxisomal membrane protein 3) (Peroxisome assembly factor 1) (PAF-1) (RING finger protein 72) | EBI-25686067 | 0.35 |
P28068 | HLA class II histocompatibility antigen, DM beta chain (MHC class II antigen DMB) (Really interesting new gene 7 protein) | EBI-25686067 | 0.35 |
P26038 | Moesin (Membrane-organizing extension spike protein) | EBI-25686067 | 0.35 |
P04114 | Apolipoprotein B-100 (Apo B-100) [Cleaved into: Apolipoprotein B-48 (Apo B-48)] | EBI-25686067 | 0.53 |
P04035 | 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMG-CoA reductase) (EC 1.1.1.34) | EBI-25686067 | 0.35 |
P03905 | NADH-ubiquinone oxidoreductase chain 4 (EC 7.1.1.2) (NADH dehydrogenase subunit 4) | EBI-25686067 | 0.35 |
P00167 | Cytochrome b5 (Microsomal cytochrome b5 type A) (MCB5) | EBI-25686067 | 0.35 |
O95395 | Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 (EC 2.4.1.102) (EC 2.4.1.148) (EC 2.4.1.150) (C2GnT-mucin type) (C2GnT-M) (hC2GnT-M) (Core 2/core 4 beta-1,6-N-acetylglucosaminyltransferase) (C2/4GnT) | EBI-25686067 | 0.35 |
O76024 | Wolframin | EBI-25686067 | 0.53 |
O60779 | Thiamine transporter 1 (ThTr-1) (ThTr1) (Solute carrier family 19 member 2) (Thiamine carrier 1) (TC1) | EBI-25686067 | 0.35 |
O43402 | ER membrane protein complex subunit 8 (Neighbor of COX4) (Protein FAM158B) | EBI-25686067 | 0.35 |
O43292 | Glycosylphosphatidylinositol anchor attachment 1 protein (GPI anchor attachment protein 1) (GAA1 protein homolog) (hGAA1) | EBI-25686067 | 0.35 |
O00400 | Acetyl-coenzyme A transporter 1 (AT-1) (Acetyl-CoA transporter 1) (Solute carrier family 33 member 1) | EBI-25686067 | 0.35 |
O00151 | PDZ and LIM domain protein 1 (C-terminal LIM domain protein 1) (Elfin) (LIM domain protein CLP-36) | EBI-25686067 | 0.35 |
B7ZAQ6 | Golgi pH regulator A (Protein GPR89A) (Putative MAPK-activating protein PM01) (Putative NF-kappa-B-activating protein 90) | EBI-25686067 | 0.35 |
Q9BYW2 | Histone-lysine N-methyltransferase SETD2 (EC 2.1.1.359) (HIF-1) (Huntingtin yeast partner B) (Huntingtin-interacting protein 1) (HIP-1) (Huntingtin-interacting protein B) (Lysine N-methyltransferase 3A) (Protein-lysine N-methyltransferase SETD2) (EC 2.1.1.-) (SET domain-containing protein 2) (hSET2) (p231HBP) | EBI-25686251 | 0.35 |
Q86VP1 | Tax1-binding protein 1 (TRAF6-binding protein) | EBI-25686251 | 0.35 |
P42226 | Signal transducer and activator of transcription 6 (IL-4 Stat) | EBI-25686251 | 0.35 |
J3QS39 | Polyubiquitin-B | EBI-25691145 | 0.62 |
P05161 | Ubiquitin-like protein ISG15 (Interferon-induced 15 kDa protein) (Interferon-induced 17 kDa protein) (IP17) (Ubiquitin cross-reactive protein) (hUCRP) | EBI-25691177 | 0.91 |
Q64339 | Ubiquitin-like protein ISG15 (Interferon-induced 15 kDa protein) (Interferon-induced 17 kDa protein) (IP17) (Ubiquitin cross-reactive protein) | EBI-25691525 | 0.79 |
Q9UBQ5 | Eukaryotic translation initiation factor 3 subunit K (eIF3k) (Eukaryotic translation initiation factor 3 subunit 12) (Muscle-specific gene M9 protein) (PLAC-24) (eIF-3 p25) (eIF-3 p28) | EBI-25765840 | 0.35 |
Q96CT7 | Coiled-coil domain-containing protein 124 | EBI-25765840 | 0.35 |
Q9BY44 | Eukaryotic translation initiation factor 2A (eIF-2A) (65 kDa eukaryotic translation initiation factor 2A) [Cleaved into: Eukaryotic translation initiation factor 2A, N-terminally processed] | EBI-25765840 | 0.35 |
O15372 | Eukaryotic translation initiation factor 3 subunit H (eIF3h) (Eukaryotic translation initiation factor 3 subunit 3) (eIF-3-gamma) (eIF3 p40 subunit) | EBI-25765840 | 0.35 |
Q7L2H7 | Eukaryotic translation initiation factor 3 subunit M (eIF3m) (Fetal lung protein B5) (hFL-B5) (PCI domain-containing protein 1) | EBI-25765840 | 0.35 |
Q13347 | Eukaryotic translation initiation factor 3 subunit I (eIF3i) (Eukaryotic translation initiation factor 3 subunit 2) (TGF-beta receptor-interacting protein 1) (TRIP-1) (eIF-3-beta) (eIF3 p36) | EBI-25765840 | 0.48 |
P68104 | Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor Tu) (EF-Tu) (Eukaryotic elongation factor 1 A-1) (eEF1A-1) (Leukocyte receptor cluster member 7) | EBI-25765840 | 0.35 |
O00303 | Eukaryotic translation initiation factor 3 subunit F (eIF3f) (Deubiquitinating enzyme eIF3f) (EC 3.4.19.12) (Eukaryotic translation initiation factor 3 subunit 5) (eIF-3-epsilon) (eIF3 p47) | EBI-25765840 | 0.35 |
P41091 | Eukaryotic translation initiation factor 2 subunit 3 (EC 3.6.5.3) (Eukaryotic translation initiation factor 2 subunit gamma X) (eIF-2-gamma X) (eIF-2gX) | EBI-25765840 | 0.35 |
P61221 | ATP-binding cassette sub-family E member 1 (2'-5'-oligoadenylate-binding protein) (HuHP68) (RNase L inhibitor) (Ribonuclease 4 inhibitor) (RNS4I) | EBI-25765840 | 0.35 |
O15371 | Eukaryotic translation initiation factor 3 subunit D (eIF3d) (Eukaryotic translation initiation factor 3 subunit 7) (eIF-3-zeta) (eIF3 p66) | EBI-25765840 | 0.35 |
Q9Y262 | Eukaryotic translation initiation factor 3 subunit L (eIF3l) (Eukaryotic translation initiation factor 3 subunit 6-interacting protein) (Eukaryotic translation initiation factor 3 subunit E-interacting protein) | EBI-25765840 | 0.35 |
Q99613 | Eukaryotic translation initiation factor 3 subunit C (eIF3c) (Eukaryotic translation initiation factor 3 subunit 8) (eIF3 p110) | EBI-25765840 | 0.35 |
Q14152 | Eukaryotic translation initiation factor 3 subunit A (eIF3a) (Eukaryotic translation initiation factor 3 subunit 10) (eIF-3-theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) | EBI-25765840 | 0.35 |
Q9BYX4 | Interferon-induced helicase C domain-containing protein 1 (EC 3.6.4.13) (Clinically amyopathic dermatomyositis autoantigen 140 kDa) (CADM-140 autoantigen) (Helicase with 2 CARD domains) (Helicard) (Interferon-induced with helicase C domain protein 1) (Melanoma differentiation-associated protein 5) (MDA-5) (Murabutide down-regulated protein) (RIG-I-like receptor 2) (RLR-2) (RNA helicase-DEAD box protein 116) | EBI-26895043 | 0.52 |
Q5RKT7 | Ubiquitin-40S ribosomal protein S27a (Ubiquitin carboxyl extension protein 80) | EBI-25828920 | 0.32 |
P62945 | 60S ribosomal protein L41 (HG12) (Large ribosomal subunit protein eL41) | EBI-25828920 | 0.32 |
P62280 | 40S ribosomal protein S11 (Small ribosomal subunit protein uS17) | EBI-25828920 | 0.32 |
P62277 | 40S ribosomal protein S13 (Small ribosomal subunit protein uS15) | EBI-25828920 | 0.32 |
P62841 | 40S ribosomal protein S15 (RIG protein) (Small ribosomal subunit protein uS19) | EBI-27030072 | 0.35 |
P62244 | 40S ribosomal protein S15a (Small ribosomal subunit protein uS8) | EBI-25828920 | 0.32 |
P62249 | 40S ribosomal protein S16 (Small ribosomal subunit protein uS9) | EBI-25828920 | 0.32 |
P39019 | 40S ribosomal protein S19 (Small ribosomal subunit protein eS19) | EBI-27030072 | 0.35 |
P60866 | 40S ribosomal protein S20 (Small ribosomal subunit protein uS10) | EBI-25828920 | 0.32 |
P63220 | 40S ribosomal protein S21 (Small ribosomal subunit protein eS21) | EBI-25828920 | 0.32 |
P62266 | 40S ribosomal protein S23 (Small ribosomal subunit protein uS12) | EBI-25828920 | 0.32 |
P62847 | 40S ribosomal protein S24 (Small ribosomal subunit protein eS24) | EBI-25828920 | 0.32 |
P62851 | 40S ribosomal protein S25 (Small ribosomal subunit protein eS25) | EBI-25828920 | 0.32 |
P62854 | 40S ribosomal protein S26 (Small ribosomal subunit protein eS26) | EBI-25828920 | 0.32 |
P42677 | 40S ribosomal protein S27 (Metallopan-stimulin 1) (MPS-1) (Small ribosomal subunit protein eS27) | EBI-25828920 | 0.32 |
P62857 | 40S ribosomal protein S28 (Small ribosomal subunit protein eS28) | EBI-25828920 | 0.32 |
P62273 | 40S ribosomal protein S29 (Small ribosomal subunit protein uS14) | EBI-25828920 | 0.32 |
P15880 | 40S ribosomal protein S2 (40S ribosomal protein S4) (Protein LLRep3) (Small ribosomal subunit protein uS5) | EBI-25828920 | 0.53 |
P62861 | FAU ubiquitin-like and ribosomal protein S30 [Cleaved into: Ubiquitin-like protein FUBI; 40S ribosomal protein S30 (Small ribosomal subunit protein eS30)] | EBI-25828920 | 0.32 |
P23396 | 40S ribosomal protein S3 (EC 4.2.99.18) (Small ribosomal subunit protein uS3) | EBI-25828920 | 0.53 |
P61247 | 40S ribosomal protein S3a (Small ribosomal subunit protein eS1) (v-fos transformation effector protein) (Fte-1) | EBI-25828920 | 0.32 |
P62701 | 40S ribosomal protein S4, X isoform (SCR10) (Single copy abundant mRNA protein) (Small ribosomal subunit protein eS4) | EBI-25828920 | 0.32 |
P62753 | 40S ribosomal protein S6 (Phosphoprotein NP33) (Small ribosomal subunit protein eS6) | EBI-25828920 | 0.53 |
P62081 | 40S ribosomal protein S7 (Small ribosomal subunit protein eS7) | EBI-27030072 | 0.35 |
P62241 | 40S ribosomal protein S8 (Small ribosomal subunit protein eS8) | EBI-25828920 | 0.32 |
P46781 | 40S ribosomal protein S9 (Small ribosomal subunit protein uS4) | EBI-25828920 | 0.32 |
O75564 | Jerky protein homolog | EBI-26375521 | 0.35 |
O14972 | Vacuolar protein sorting-associated protein 26C (Down syndrome critical region protein 3) (Down syndrome critical region protein A) | EBI-26375521 | 0.35 |
Q96LT9 | RNA-binding region-containing protein 3 (RNA-binding motif protein 40) (RNA-binding protein 40) (U11/U12 small nuclear ribonucleoprotein 65 kDa protein) (U11/U12 snRNP 65 kDa protein) (U11/U12-65K) | EBI-26375521 | 0.35 |
Q9Y6G5 | COMM domain-containing protein 10 | EBI-26375521 | 0.35 |
Q9Y2K2 | Serine/threonine-protein kinase SIK3 (EC 2.7.11.1) (Salt-inducible kinase 3) (SIK-3) (Serine/threonine-protein kinase QSK) | EBI-26375521 | 0.35 |
Q9Y2D8 | Afadin- and alpha-actinin-binding protein (ADIP) (Afadin DIL domain-interacting protein) (SSX2-interacting protein) | EBI-26375521 | 0.67 |
Q9UN81 | LINE-1 retrotransposable element ORF1 protein (L1ORF1p) (LINE retrotransposable element 1) (LINE1 retrotransposable element 1) | EBI-26375521 | 0.35 |
Q9UKF6 | Cleavage and polyadenylation specificity factor subunit 3 (EC 3.1.27.-) (Cleavage and polyadenylation specificity factor 73 kDa subunit) (CPSF 73 kDa subunit) (mRNA 3'-end-processing endonuclease CPSF-73) | EBI-26375521 | 0.35 |
Q9UHP3 | Ubiquitin carboxyl-terminal hydrolase 25 (EC 3.4.19.12) (Deubiquitinating enzyme 25) (USP on chromosome 21) (Ubiquitin thioesterase 25) (Ubiquitin-specific-processing protease 25) | EBI-26375521 | 0.76 |
Q9UBI1 | COMM domain-containing protein 3 (Protein Bup) (Protein PIL) | EBI-26375521 | 0.35 |
Q9P2S5 | WD repeat-containing protein WRAP73 (WD repeat-containing protein 8) (WD repeat-containing protein antisense to TP73 gene) | EBI-26375521 | 0.35 |
Q9P2D0 | Inhibitor of Bruton tyrosine kinase (IBtk) | EBI-26375521 | 0.35 |
Q9P000 | COMM domain-containing protein 9 | EBI-26375521 | 0.35 |
Q9NX08 | COMM domain-containing protein 8 | EBI-26375521 | 0.35 |
Q9NVH2 | Integrator complex subunit 7 (Int7) | EBI-26375521 | 0.35 |
Q9H4B6 | Protein salvador homolog 1 (45 kDa WW domain protein) (hWW45) | EBI-26375521 | 0.35 |
Q9GZQ3 | COMM domain-containing protein 5 (Hypertension-related calcium-regulated gene protein) (HCaRG) | EBI-26375521 | 0.35 |
Q96II8 | DISP complex protein LRCH3 (Leucine-rich repeat and calponin homology domain-containing protein 3) | EBI-26375521 | 0.35 |
Q8N668 | COMM domain-containing protein 1 (Protein Murr1) | EBI-26375521 | 0.35 |
Q86X10 | Ral GTPase-activating protein subunit beta (p170) | EBI-26375521 | 0.35 |
Q86W92 | Liprin-beta-1 (Protein tyrosine phosphatase receptor type f polypeptide-interacting protein-binding protein 1) (PTPRF-interacting protein-binding protein 1) (hSGT2) | EBI-26375521 | 0.67 |
Q86SQ0 | Pleckstrin homology-like domain family B member 2 (Protein LL5-beta) | EBI-26375521 | 0.35 |
Q7Z4G1 | COMM domain-containing protein 6 | EBI-26375521 | 0.35 |
Q7Z3J2 | VPS35 endosomal protein-sorting factor-like (Esophageal cancer-associated protein) | EBI-26375521 | 0.35 |
Q6ZWJ1 | Syntaxin-binding protein 4 (Syntaxin 4-interacting protein) (STX4-interacting protein) (Synip) | EBI-26375521 | 0.35 |
Q6ZU80 | Centrosomal protein of 128 kDa (Cep128) | EBI-26375521 | 0.35 |
Q6IEG0 | U11/U12 small nuclear ribonucleoprotein 48 kDa protein (U11/U12 snRNP 48 kDa protein) (U11/U12-48K) | EBI-26375521 | 0.35 |
Q6GYQ0 | Ral GTPase-activating protein subunit alpha-1 (GAP-related-interacting partner to E12) (GRIPE) (GTPase-activating Rap/Ran-GAP domain-like 1) (Tuberin-like protein 1) (p240) | EBI-26375521 | 0.35 |
Q63ZY3 | KN motif and ankyrin repeat domain-containing protein 2 (Ankyrin repeat domain-containing protein 25) (Matrix-remodeling-associated protein 3) (SRC-1-interacting protein) (SIP) (SRC-interacting protein) (SRC1-interacting protein) | EBI-26375521 | 0.35 |
Q5VUJ6 | Leucine-rich repeat and calponin homology domain-containing protein 2 | EBI-26375521 | 0.35 |
Q5SZL2 | Centrosomal protein of 85 kDa-like (Serologically defined breast cancer antigen NY-BR-15) | EBI-26375521 | 0.35 |
Q5SVZ6 | Zinc finger MYM-type protein 1 | EBI-26375521 | 0.35 |
Q567U6 | Coiled-coil domain-containing protein 93 | EBI-26375521 | 0.35 |
Q53EZ4 | Centrosomal protein of 55 kDa (Cep55) (Up-regulated in colon cancer 6) | EBI-26375521 | 0.35 |
Q15345 | Leucine-rich repeat-containing protein 41 (Protein Muf1) | EBI-26375521 | 0.35 |
Q13188 | Serine/threonine-protein kinase 3 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 2) (MST-2) (STE20-like kinase MST2) (Serine/threonine-protein kinase Krs-1) [Cleaved into: Serine/threonine-protein kinase 3 36kDa subunit (MST2/N); Serine/threonine-protein kinase 3 20kDa subunit (MST2/C)] | EBI-26375521 | 0.35 |
Q13049 | E3 ubiquitin-protein ligase TRIM32 (EC 2.3.2.27) (72 kDa Tat-interacting protein) (RING-type E3 ubiquitin transferase TRIM32) (Tripartite motif-containing protein 32) (Zinc finger protein HT2A) | EBI-26375521 | 0.67 |
Q13043 | Serine/threonine-protein kinase 4 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 1) (MST-1) (STE20-like kinase MST1) (Serine/threonine-protein kinase Krs-2) [Cleaved into: Serine/threonine-protein kinase 4 37kDa subunit (MST1/N); Serine/threonine-protein kinase 4 18kDa subunit (MST1/C)] | EBI-26375521 | 0.35 |
Q12923 | Tyrosine-protein phosphatase non-receptor type 13 (EC 3.1.3.48) (Fas-associated protein-tyrosine phosphatase 1) (FAP-1) (PTP-BAS) (Protein-tyrosine phosphatase 1E) (PTP-E1) (hPTPE1) (Protein-tyrosine phosphatase PTPL1) | EBI-26375521 | 0.35 |
Q05086 | Ubiquitin-protein ligase E3A (EC 2.3.2.26) (E6AP ubiquitin-protein ligase) (HECT-type ubiquitin transferase E3A) (Human papillomavirus E6-associated protein) (Oncogenic protein-associated protein E6-AP) (Renal carcinoma antigen NY-REN-54) | EBI-26375521 | 0.35 |
P51530 | DNA replication ATP-dependent helicase/nuclease DNA2 (hDNA2) (DNA replication ATP-dependent helicase-like homolog) [Includes: DNA replication nuclease DNA2 (EC 3.1.-.-); DNA replication ATP-dependent helicase DNA2 (EC 3.6.4.12)] | EBI-26375521 | 0.35 |
P28838 | Cytosol aminopeptidase (EC 3.4.11.1) (Cysteinylglycine-S-conjugate dipeptidase) (EC 3.4.13.23) (Leucine aminopeptidase 3) (LAP-3) (Leucyl aminopeptidase) (Peptidase S) (Proline aminopeptidase) (EC 3.4.11.5) (Prolyl aminopeptidase) | EBI-26375521 | 0.62 |
O95754 | Semaphorin-4F (Semaphorin-M) (Sema M) (Semaphorin-W) (Sema W) | EBI-26375521 | 0.35 |
O95714 | E3 ubiquitin-protein ligase HERC2 (EC 2.3.2.26) (HECT domain and RCC1-like domain-containing protein 2) (HECT-type E3 ubiquitin transferase HERC2) | EBI-26375521 | 0.35 |
O75665 | Centriole and centriolar satellite protein OFD1 (Oral-facial-digital syndrome 1 protein) (Protein 71-7A) | EBI-26375521 | 0.35 |
O75382 | Tripartite motif-containing protein 3 (Brain-expressed RING finger protein) (RING finger protein 22) (RING finger protein 97) | EBI-26375521 | 0.67 |
O43933 | Peroxisome biogenesis factor 1 (Peroxin-1) (Peroxisome biogenesis disorder protein 1) | EBI-26375521 | 0.35 |
Q14653 | Interferon regulatory factor 3 (IRF-3) | EBI-26583175 | 0.44 |
Q15750 | TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 (Mitogen-activated protein kinase kinase kinase 7-interacting protein 1) (TGF-beta-activated kinase 1-binding protein 1) (TAK1-binding protein 1) | EBI-26583273 | 0.44 |
P59046 | NACHT, LRR and PYD domains-containing protein 12 (Monarch-1) (PYRIN-containing APAF1-like protein 7) (Regulated by nitric oxide) | EBI-26583398 | 0.44 |
E9Q5R7 | NACHT, LRR and PYD domains-containing protein 12 (Monarch-1) (PYRIN-containing APAF1-like protein 7) (PYPAF7) | EBI-26583416 | 0.44 |
P0CG48 | Polyubiquitin-C [Cleaved into: Ubiquitin] | EBI-26583643 | 0.56 |
P37837 | Transaldolase (EC 2.2.1.2) | EBI-26584235 | 0.35 |
P38646 | Stress-70 protein, mitochondrial (75 kDa glucose-regulated protein) (GRP-75) (Heat shock 70 kDa protein 9) (Mortalin) (MOT) (Peptide-binding protein 74) (PBP74) | EBI-26584235 | 0.35 |
P09382 | Galectin-1 (Gal-1) (14 kDa laminin-binding protein) (HLBP14) (14 kDa lectin) (Beta-galactoside-binding lectin L-14-I) (Galaptin) (HBL) (HPL) (Lactose-binding lectin 1) (Lectin galactoside-binding soluble 1) (Putative MAPK-activating protein PM12) (S-Lac lectin 1) | EBI-26584235 | 0.35 |
P61978 | Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (Transformation up-regulated nuclear protein) (TUNP) | EBI-26584235 | 0.35 |
P78527 | DNA-dependent protein kinase catalytic subunit (DNA-PK catalytic subunit) (DNA-PKcs) (EC 2.7.11.1) (DNPK1) (p460) | EBI-26584235 | 0.35 |
P25963 | NF-kappa-B inhibitor alpha (I-kappa-B-alpha) (IkB-alpha) (IkappaBalpha) (Major histocompatibility complex enhancer-binding protein MAD3) | EBI-26585856 | 0.44 |
Q13616 | Cullin-1 (CUL-1) | EBI-26585236 | 0.44 |
O02741 | Ubiquitin-like protein ISG15 (Interferon-stimulated gene product 17) (Ubiquitin cross-reactive protein) (BoUCRP) | EBI-26601418 | 0.44 |
B2LUG8 | Interferon stimulated gene 15 | EBI-26601473 | 0.44 |
A0A5N4DAX7 | Ubiquitin-like protein ISG15 | EBI-26601486 | 0.44 |
Q9GKP4 | EBI-26602287 | 0.44 | |
L5LC70 | Ubiquitin-like protein ISG15 | EBI-26602296 | 0.44 |
A0A1S2ZWT3 | ubiquitin-like protein ISG15 | EBI-26602342 | 0.44 |
R9QB93 | ISG15 | EBI-26602358 | 0.44 |
O75360 | Homeobox protein prophet of Pit-1 (PROP-1) (Pituitary-specific homeodomain factor) | EBI-26949889 | 0.56 |
Q2TAC2 | Coiled-coil domain-containing protein 57 | EBI-26950001 | 0.56 |
P53675 | Clathrin heavy chain 2 (Clathrin heavy chain on chromosome 22) (CLH-22) | EBI-26950023 | 0.56 |
Q9Y2V7 | Conserved oligomeric Golgi complex subunit 6 (COG complex subunit 6) (Component of oligomeric Golgi complex 6) | EBI-26950034 | 0.56 |
A6NEM1 | Golgin subfamily A member 6-like protein 9 | EBI-26950056 | 0.56 |
Q9Y6K9 | NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier) | EBI-26950067 | 0.56 |
O60229 | Kalirin (EC 2.7.11.1) (Huntingtin-associated protein-interacting protein) (Protein Duo) (Serine/threonine-protein kinase with Dbl- and pleckstrin homology domain) | EBI-26950078 | 0.56 |
P52954 | Transcription factor LBX1 (Ladybird homeobox protein homolog 1) | EBI-26950089 | 0.56 |
Q5JR59 | Microtubule-associated tumor suppressor candidate 2 (Cardiac zipper protein) (Microtubule plus-end tracking protein TIP150) (Tracking protein of 150 kDa) | EBI-26950111 | 0.56 |
A8MTQ0 | Homeobox protein notochord | EBI-26950122 | 0.56 |
Q04864 | Proto-oncogene c-Rel | EBI-26950144 | 0.56 |
Q15427 | Splicing factor 3B subunit 4 (Pre-mRNA-splicing factor SF3b 49 kDa subunit) (Spliceosome-associated protein 49) (SAP 49) | EBI-26950155 | 0.56 |
Q9BXI9 | Complement C1q tumor necrosis factor-related protein 6 | EBI-26949990 | 0.60 |
P14373 | Zinc finger protein RFP (EC 2.3.2.27) (RING finger protein 76) (RING-type E3 ubiquitin transferase TRIM27) (Ret finger protein) (Tripartite motif-containing protein 27) | EBI-26950199 | 0.56 |
Q12933 | TNF receptor-associated factor 2 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF2) (RING-type E3 ubiquitin transferase TRAF2) (Tumor necrosis factor type 2 receptor-associated protein 3) | EBI-26950188 | 0.56 |
Q13077 | TNF receptor-associated factor 1 (Epstein-Barr virus-induced protein 6) | EBI-26950177 | 0.56 |
Q86XT4 | E3 ubiquitin-protein ligase TRIM50 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase TRIM50) (Tripartite motif-containing protein 50) | EBI-26950210 | 0.56 |
Q96R06 | Sperm-associated antigen 5 (Astrin) (Deepest) (Mitotic spindle-associated protein p126) (MAP126) | EBI-26950166 | 0.56 |
Q9H257 | Caspase recruitment domain-containing protein 9 (hCARD9) | EBI-26950823 | 0.56 |
Q8WWH4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 (Ankyrin-like protein 1) (Germ cell-specific ankyrin, SAM and basic leucine zipper domain-containing protein) | EBI-26950812 | 0.60 |
Q4VCS5 | Angiomotin | EBI-26950801 | 0.56 |
O95273 | Cyclin-D1-binding protein 1 (Grap2 and cyclin-D-interacting protein) (Human homolog of Maid) | EBI-26950835 | 0.63 |
P08670 | Vimentin | EBI-26951264 | 0.56 |
Q9BYV2 | Tripartite motif-containing protein 54 (Muscle-specific RING finger protein) (MuRF) (Muscle-specific RING finger protein 3) (MuRF-3) (MuRF3) (RING finger protein 30) | EBI-26951242 | 0.56 |
Q9C040 | Tripartite motif-containing protein 2 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRIM2) (RING finger protein 86) (RING-type E3 ubiquitin transferase TRIM2) | EBI-26951198 | 0.60 |
Q9H5L6 | DNA transposase THAP9 (EC 2.7.7.-) (THAP domain-containing protein 9) (hTh9) | EBI-26951187 | 0.56 |
Q8WW24 | Tektin-4 | EBI-26951176 | 0.56 |
Q8N0S2 | Synaptonemal complex central element protein 1 (Cancer/testis antigen 76) (CT76) | EBI-26951165 | 0.56 |
Q9UHV2 | SERTA domain-containing protein 1 (CDK4-binding protein p34SEI1) (SEI-1) (p34(SEI-1)) (Transcriptional regulator interacting with the PHD-bromodomain 1) (TRIP-Br1) | EBI-26951132 | 0.56 |
Q96QF0 | Rab-3A-interacting protein (Rab3A-interacting protein) (Rabin-3) (SSX2-interacting protein) | EBI-26951110 | 0.60 |
Q8TBN0 | Guanine nucleotide exchange factor for Rab-3A (Rab-3A-interacting-like protein 1) (Rab3A-interacting-like protein 1) (Rabin3-like 1) | EBI-26951099 | 0.56 |
P11217 | Glycogen phosphorylase, muscle form (EC 2.4.1.1) (Myophosphorylase) | EBI-26951088 | 0.56 |
P41219 | Peripherin (Neurofilament 4) | EBI-26951077 | 0.56 |
Q8ND90 | Paraneoplastic antigen Ma1 (37 kDa neuronal protein) (Neuron- and testis-specific protein 1) | EBI-26951044 | 0.56 |
Q9HBI0 | Gamma-parvin | EBI-26951033 | 0.56 |
Q6UWW0 | Lipocalin-15 | EBI-26950989 | 0.56 |
Q6A163 | Keratin, type I cytoskeletal 39 (Cytokeratin-39) (CK-39) (Keratin-39) (K39) (Type I hair keratin Ka35) | EBI-26950967 | 0.56 |
Q14532 | Keratin, type I cuticular Ha2 (Hair keratin, type I Ha2) (Keratin-32) (K32) | EBI-26950956 | 0.56 |
Q15323 | Keratin, type I cuticular Ha1 (Hair keratin, type I Ha1) (Keratin-31) (K31) | EBI-26950945 | 0.56 |
Q7Z3Y8 | Keratin, type I cytoskeletal 27 (Cytokeratin-27) (CK-27) (Keratin-25C) (K25C) (Keratin-27) (K27) (Type I inner root sheath-specific keratin-K25irs3) | EBI-26950934 | 0.56 |
P13646 | Keratin, type I cytoskeletal 13 (Cytokeratin-13) (CK-13) (Keratin-13) (K13) | EBI-26950923 | 0.56 |
Q9UKT9 | Zinc finger protein Aiolos (Ikaros family zinc finger protein 3) | EBI-26950901 | 0.56 |
Q8IX15 | Homeobox and leucine zipper protein Homez (Homeodomain leucine zipper-containing factor) | EBI-26950890 | 0.60 |
Q04446 | 1,4-alpha-glucan-branching enzyme (EC 2.4.1.18) (Brancher enzyme) (Glycogen-branching enzyme) | EBI-26950857 | 0.56 |
Q9UGI0 | Ubiquitin thioesterase ZRANB1 (EC 3.4.19.12) (TRAF-binding domain-containing protein) (hTrabid) (Zinc finger Ran-binding domain-containing protein 1) | EBI-26951286 | 0.56 |
Q8N1B4 | Vacuolar protein sorting-associated protein 52 homolog (SAC2 suppressor of actin mutations 2-like protein) | EBI-26951275 | 0.56 |
Q8IYX8 | Centrosomal protein CEP57L1 (Centrosomal protein 57kDa-like protein 1) (Centrosomal protein of 57 kDa-related protein) (Cep57R) (Cep57-related protein) | EBI-26952645 | 0.56 |
Q13064 | Probable E3 ubiquitin-protein ligase makorin-3 (EC 2.3.2.27) (RING finger protein 63) (RING-type E3 ubiquitin transferase makorin-3) (Zinc finger protein 127) | EBI-26952689 | 0.56 |
O95429 | BAG family molecular chaperone regulator 4 (BAG-4) (Bcl-2-associated athanogene 4) (Silencer of death domains) | EBI-26952867 | 0.56 |
Q86Y26 | NUT family member 1 (Nuclear protein in testis) | EBI-26953109 | 0.56 |
P15884 | Transcription factor 4 (TCF-4) (Class B basic helix-loop-helix protein 19) (bHLHb19) (Immunoglobulin transcription factor 2) (ITF-2) (SL3-3 enhancer factor 2) (SEF-2) | EBI-26953260 | 0.56 |
P23497 | Nuclear autoantigen Sp-100 (Nuclear dot-associated Sp100 protein) (Speckled 100 kDa) | EBI-26953249 | 0.56 |
P56192 | Methionine--tRNA ligase, cytoplasmic (EC 6.1.1.10) (Methionyl-tRNA synthetase) (MetRS) | EBI-26949366 | 0.49 |
Q9NXS3 | Kelch-like protein 28 (BTB/POZ domain-containing protein 5) | EBI-26949355 | 0.49 |
A8MW99 | Meiosis-specific protein MEI4 | EBI-26949411 | 0.49 |
Q9NR56 | Muscleblind-like protein 1 (Triplet-expansion RNA-binding protein) | EBI-26949575 | 0.49 |
A8MRT5 | Nuclear pore complex-interacting protein family member B5 | EBI-26949601 | 0.49 |
Q9H361 | Polyadenylate-binding protein 3 (PABP-3) (Poly(A)-binding protein 3) (Testis-specific poly(A)-binding protein) | EBI-26949612 | 0.49 |
P23759 | Paired box protein Pax-7 (HuP1) | EBI-26949623 | 0.49 |
Q8TE12 | LIM homeobox transcription factor 1-alpha (LIM/homeobox protein 1.1) (LMX-1.1) (LIM/homeobox protein LMX1A) | EBI-26949564 | 0.49 |
Q9BQ66 | Keratin-associated protein 4-12 (Keratin-associated protein 4.12) (Ultrahigh sulfur keratin-associated protein 4.12) | EBI-26949553 | 0.49 |
Q96D03 | DNA damage-inducible transcript 4-like protein (HIF-1 responsive protein RTP801-like) (Protein regulated in development and DNA damage response 2) (REDD-2) | EBI-26949542 | 0.49 |
Q8N684 | Cleavage and polyadenylation specificity factor subunit 7 (Cleavage and polyadenylation specificity factor 59 kDa subunit) (CPSF 59 kDa subunit) (Cleavage factor Im complex 59 kDa subunit) (CFIm59) (Pre-mRNA cleavage factor Im 59 kDa subunit) | EBI-26949531 | 0.49 |
Q96NS8 | Putative protein CLUHP3 (Clustered mitochondria (cluA/CLU1) homolog pseudogene 3) (KIAA0664-like protein 3) | EBI-26949520 | 0.49 |
Q96P56 | Cation channel sperm-associated protein 2 (CatSper2) | EBI-26949498 | 0.49 |
Q96B67 | Arrestin domain-containing protein 3 (TBP-2-like inducible membrane protein) (TLIMP) | EBI-26949487 | 0.49 |
Q09666 | Neuroblast differentiation-associated protein AHNAK (Desmoyokin) | EBI-26949476 | 0.49 |
Q9NX63 | MICOS complex subunit MIC19 (Coiled-coil-helix-coiled-coil-helix domain-containing protein 3) | EBI-26949509 | 0.49 |
Q7Z3I7 | Zinc finger protein 572 | EBI-26949711 | 0.49 |
Q96AQ6 | Pre-B-cell leukemia transcription factor-interacting protein 1 (Hematopoietic PBX-interacting protein) | EBI-26949634 | 0.49 |
Q9NP87 | DNA-directed DNA/RNA polymerase mu (Pol Mu) (EC 2.7.7.7) (Terminal transferase) | EBI-26949645 | 0.49 |
Q9BRQ0 | Pygopus homolog 2 | EBI-26949656 | 0.49 |
Q9NTJ5 | Phosphatidylinositol-3-phosphatase SAC1 (EC 3.1.3.64) (Phosphatidylinositol-4-phosphate phosphatase) (Suppressor of actin mutations 1-like protein) | EBI-26949667 | 0.49 |
P50453 | Serpin B9 (Cytoplasmic antiproteinase 3) (CAP-3) (CAP3) (Peptidase inhibitor 9) (PI-9) | EBI-26949678 | 0.49 |
Q9BXI2 | Mitochondrial ornithine transporter 2 (Solute carrier family 25 member 2) | EBI-26949689 | 0.49 |
P17023 | Zinc finger protein 19 (Zinc finger protein KOX12) | EBI-26949700 | 0.49 |
Q8WWN8 | Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 (Centaurin-delta-3) (Cnt-d3) | EBI-26949911 | 0.49 |
Q96CW7 | C4orf42 protein (HCG1818415) | EBI-26949922 | 0.49 |
P49765 | Vascular endothelial growth factor B (VEGF-B) (VEGF-related factor) (VRF) | EBI-26949944 | 0.49 |
Q92546 | RAB6A-GEF complex partner protein 2 (Retrograde Golgi transport protein RGP1 homolog) | EBI-26950485 | 0.49 |
Q6IC83 | Uncharacterized protein C22orf42 | EBI-26950463 | 0.49 |
Q6PF05 | Tetratricopeptide repeat protein 23-like | EBI-26950529 | 0.49 |
Q8N7C3 | Probable E3 ubiquitin-protein ligase TRIML2 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase TRIML2) (SPRY domain-containing protein 6) (Tripartite motif family-like protein 2) | EBI-26950518 | 0.49 |
Q96N21 | AP-4 complex accessory subunit Tepsin (ENTH domain-containing protein 2) (Epsin for AP-4) (Tetra-epsin) | EBI-26950507 | 0.49 |
Q86T65 | Disheveled-associated activator of morphogenesis 2 | EBI-26951858 | 0.49 |
Q96JB2 | Conserved oligomeric Golgi complex subunit 3 (COG complex subunit 3) (Component of oligomeric Golgi complex 3) (Vesicle-docking protein SEC34 homolog) (p94) | EBI-26951847 | 0.49 |
Q8WXK4 | Ankyrin repeat and SOCS box protein 12 (ASB-12) | EBI-26951825 | 0.49 |
Q8N2N9 | Ankyrin repeat domain-containing protein 36B (CLL-associated antigen KW-1) | EBI-26951814 | 0.49 |
Q8WXI4 | Acyl-coenzyme A thioesterase 11 (Acyl-CoA thioesterase 11) (EC 3.1.2.-) (Acyl-CoA thioester hydrolase 11) (Adipose-associated thioesterase) (Brown fat-inducible thioesterase) (BFIT) (Palmitoyl-coenzyme A thioesterase) (EC 3.1.2.2) | EBI-26951792 | 0.49 |
Q6KB66 | Keratin, type II cytoskeletal 80 (Cytokeratin-80) (CK-80) (Keratin-80) (K80) (Type-II keratin Kb20) | EBI-26951913 | 0.49 |
P00488 | Coagulation factor XIII A chain (Coagulation factor XIIIa) (EC 2.3.2.13) (Protein-glutamine gamma-glutamyltransferase A chain) (Transglutaminase A chain) | EBI-26951891 | 0.49 |
Q14562 | ATP-dependent RNA helicase DHX8 (EC 3.6.4.13) (DEAH box protein 8) (RNA helicase HRH1) | EBI-26951869 | 0.49 |
P61758 | Prefoldin subunit 3 (HIBBJ46) (von Hippel-Lindau-binding protein 1) (VBP-1) (VHL-binding protein 1) | EBI-26952089 | 0.49 |
Q5W5X9 | Tetratricopeptide repeat protein 23 (TPR repeat protein 23) (Cervical cancer proto-oncogene 8 protein) (HCC-8) | EBI-26952067 | 0.49 |
Q96H20 | Vacuolar-sorting protein SNF8 (ELL-associated protein of 30 kDa) (ESCRT-II complex subunit VPS22) (hVps22) | EBI-26952034 | 0.49 |
Q86VW0 | SEC14 domain and spectrin repeat-containing protein 1 (Huntingtin-interacting protein-like protein) (Protein Solo) | EBI-26952023 | 0.49 |
Q6NUQ1 | RAD50-interacting protein 1 (RAD50 interactor 1) (HsRINT-1) (RINT-1) | EBI-26952012 | 0.49 |
A6NK89 | Ras association domain-containing protein 10 | EBI-26952001 | 0.49 |
Q6IN85 | Serine/threonine-protein phosphatase 4 regulatory subunit 3A (SMEK homolog 1) | EBI-26951979 | 0.49 |
Q07869 | Peroxisome proliferator-activated receptor alpha (PPAR-alpha) (Nuclear receptor subfamily 1 group C member 1) | EBI-26951968 | 0.49 |
P17568 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 (Cell adhesion protein SQM1) (Complex I-B18) (CI-B18) (NADH-ubiquinone oxidoreductase B18 subunit) | EBI-26951957 | 0.49 |
A9UHW6 | MIF4G domain-containing protein (SLBP-interacting protein 1) (hSLIP1) | EBI-26951946 | 0.49 |
P26842 | CD27 antigen (CD27L receptor) (T-cell activation antigen CD27) (T14) (Tumor necrosis factor receptor superfamily member 7) (CD antigen CD27) | EBI-26952961 | 0.56 |
P25942 | Tumor necrosis factor receptor superfamily member 5 (B-cell surface antigen CD40) (Bp50) (CD40L receptor) (CDw40) (CD antigen CD40) | EBI-26952972 | 0.49 |
Q6UWB1 | Interleukin-27 receptor subunit alpha (IL-27 receptor subunit alpha) (IL-27R subunit alpha) (IL-27R-alpha) (IL-27RA) (Cytokine receptor WSX-1) (Cytokine receptor-like 1) (Type I T-cell cytokine receptor) (TCCR) (ZcytoR1) | EBI-26952983 | 0.49 |
Q16553 | Lymphocyte antigen 6E (Ly-6E) (Retinoic acid-induced gene E protein) (RIG-E) (Stem cell antigen 2) (SCA-2) (Thymic shared antigen 1) (TSA-1) | EBI-26952994 | 0.56 |
Q6UWN5 | Ly6/PLAUR domain-containing protein 5 | EBI-26953005 | 0.49 |
P54274 | Telomeric repeat-binding factor 1 (NIMA-interacting protein 2) (TTAGGG repeat-binding factor 1) (Telomeric protein Pin2/TRF1) | EBI-26953131 | 0.49 |
A0A663DJA2 | Putative ORF10 protein | EBI-26953397 | 0.49 |
P0DTD2 | ORF9b protein (ORF9b) (Accessory protein 9b) (ORF-9b) (Protein 9b) | EBI-26954139 | 0.49 |
P0DTC2 | Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) [Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2'] | EBI-26954338 | 0.49 |
P13533 | Myosin-6 (Myosin heavy chain 6) (Myosin heavy chain, cardiac muscle alpha isoform) (MyHC-alpha) | EBI-26996222 | 0.44 |
P07225 | Vitamin K-dependent protein S | EBI-26996294 | 0.44 |
Q9BZS1 | Forkhead box protein P3 (Scurfin) [Cleaved into: Forkhead box protein P3, C-terminally processed; Forkhead box protein P3 41 kDa form] | EBI-26996969 | 0.44 |
Q15303 | Receptor tyrosine-protein kinase erbB-4 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-4) (Tyrosine kinase-type cell surface receptor HER4) (p180erbB4) [Cleaved into: ERBB4 intracellular domain (4ICD) (E4ICD) (s80HER4)] | EBI-26997123 | 0.44 |
Q8N0Z8 | tRNA pseudouridine synthase-like 1 (EC 5.4.99.-) (tRNA pseudouridylate synthase-like 1) (tRNA-uridine isomerase-like 1) | EBI-27030072 | 0.35 |
Q96P11 | 28S rRNA (cytosine-C(5))-methyltransferase (EC 2.1.1.-) (NOL1-related protein) (NOL1R) (NOL1/NOP2/Sun domain family member 5) (Williams-Beuren syndrome chromosomal region 20A protein) | EBI-27030072 | 0.35 |
Q9BXP2 | Solute carrier family 12 member 9 (Cation-chloride cotransporter 6) (hCCC6) (Cation-chloride cotransporter-interacting protein 1) (CCC-interacting protein 1) (hCIP1) (Potassium-chloride transporter 9) (WO3.3) | EBI-27030072 | 0.35 |
Q9Y692 | Glucocorticoid modulatory element-binding protein 1 (GMEB-1) (DNA-binding protein p96PIF) (Parvovirus initiation factor p96) (PIF p96) | EBI-27030072 | 0.35 |
Q2M1P5 | Kinesin-like protein KIF7 | EBI-27030072 | 0.35 |
Q9HCS7 | Pre-mRNA-splicing factor SYF1 (Protein HCNP) (XPA-binding protein 2) | EBI-27030072 | 0.35 |
Q9H1D9 | DNA-directed RNA polymerase III subunit RPC6 (RNA polymerase III subunit C6) (DNA-directed RNA polymerase III subunit F) (RNA polymerase III 39 kDa subunit) (RPC39) | EBI-27030072 | 0.35 |
Q13813 | Spectrin alpha chain, non-erythrocytic 1 (Alpha-II spectrin) (Fodrin alpha chain) (Spectrin, non-erythroid alpha subunit) | EBI-27030072 | 0.35 |
Q9ULC4 | Malignant T-cell-amplified sequence 1 (MCT-1) (Multiple copies T-cell malignancies) | EBI-27030072 | 0.35 |
P60900 | Proteasome subunit alpha type-6 (27 kDa prosomal protein) (PROS-27) (p27K) (Macropain iota chain) (Multicatalytic endopeptidase complex iota chain) (Proteasome iota chain) | EBI-27030072 | 0.35 |
Q13505 | Metaxin-1 (Mitochondrial outer membrane import complex protein 1) | EBI-27030072 | 0.35 |
Q8WVS4 | Cytoplasmic dynein 2 intermediate chain 1 (Dynein 2 intermediate chain 1) (WD repeat-containing protein 60) | EBI-27030072 | 0.35 |
Q53H82 | Endoribonuclease LACTB2 (EC 3.1.27.-) (Beta-lactamase-like protein 2) | EBI-27030072 | 0.35 |
O95249 | Golgi SNAP receptor complex member 1 (28 kDa Golgi SNARE protein) (28 kDa cis-Golgi SNARE p28) (GOS-28) | EBI-27030072 | 0.35 |
O75494 | Serine/arginine-rich splicing factor 10 (40 kDa SR-repressor protein) (SRrp40) (FUS-interacting serine-arginine-rich protein 1) (Splicing factor SRp38) (Splicing factor, arginine/serine-rich 13A) (TLS-associated protein with Ser-Arg repeats) (TASR) (TLS-associated protein with SR repeats) (TLS-associated serine-arginine protein) (TLS-associated SR protein) | EBI-27030072 | 0.35 |
O00469 | Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 (EC 1.14.11.4) (Lysyl hydroxylase 2) (LH2) | EBI-27030072 | 0.35 |
Q9Y312 | Protein AAR2 homolog (AAR2 splicing factor homolog) | EBI-27030072 | 0.35 |
Q9H1P3 | Oxysterol-binding protein-related protein 2 (ORP-2) (OSBP-related protein 2) | EBI-27030072 | 0.35 |
O14936 | Peripheral plasma membrane protein CASK (hCASK) (EC 2.7.11.1) (Calcium/calmodulin-dependent serine protein kinase) (Protein lin-2 homolog) | EBI-27030072 | 0.35 |
Q9NQR4 | Omega-amidase NIT2 (EC 3.5.1.3) (Nitrilase homolog 2) | EBI-27030072 | 0.35 |
O60763 | General vesicular transport factor p115 (Protein USO1 homolog) (Transcytosis-associated protein) (TAP) (Vesicle-docking protein) | EBI-27030072 | 0.35 |
Q9BZG8 | 2-(3-amino-3-carboxypropyl)histidine synthase subunit 1 (EC 2.5.1.108) (Diphthamide biosynthesis protein 1) (Diphtheria toxin resistance protein 1) (Ovarian cancer-associated gene 1 protein) (S-adenosyl-L-methionine:L-histidine 3-amino-3-carboxypropyltransferase 1) | EBI-27030072 | 0.35 |
Q7Z5K2 | Wings apart-like protein homolog (Friend of EBNA2 protein) (WAPL cohesin release factor) | EBI-27030072 | 0.35 |
Q8NB91 | Fanconi anemia group B protein (Protein FACB) (Fanconi anemia-associated polypeptide of 95 kDa) (FAAP95) | EBI-27030072 | 0.35 |
Q14186 | Transcription factor Dp-1 (DRTF1-polypeptide 1) (DRTF1) (E2F dimerization partner 1) | EBI-27030072 | 0.35 |
Q9Y285 | Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (CML33) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS) | EBI-27030072 | 0.35 |
Q86VN1 | Vacuolar protein-sorting-associated protein 36 (ELL-associated protein of 45 kDa) (ESCRT-II complex subunit VPS36) | EBI-27030072 | 0.35 |
Q96E39 | RNA binding motif protein, X-linked-like-1 (Heterogeneous nuclear ribonucleoprotein G-like 1) | EBI-27030072 | 0.35 |
Q13492 | Phosphatidylinositol-binding clathrin assembly protein (Clathrin assembly lymphoid myeloid leukemia protein) | EBI-27030072 | 0.35 |
Q9BTU6 | Phosphatidylinositol 4-kinase type 2-alpha (EC 2.7.1.67) (Phosphatidylinositol 4-kinase type II-alpha) | EBI-27030072 | 0.35 |
Q8WVV9 | Heterogeneous nuclear ribonucleoprotein L-like (hnRNPLL) (Stromal RNA-regulating factor) | EBI-27030072 | 0.52 |
Q68E01 | Integrator complex subunit 3 (Int3) (SOSS complex subunit A) (Sensor of single-strand DNA complex subunit A) (SOSS-A) (Sensor of ssDNA subunit A) | EBI-27030072 | 0.35 |
Q9NZZ3 | Charged multivesicular body protein 5 (Chromatin-modifying protein 5) (SNF7 domain-containing protein 2) (Vacuolar protein sorting-associated protein 60) (Vps60) (hVps60) | EBI-27030072 | 0.35 |
Q9BSH4 | Translational activator of cytochrome c oxidase 1 (Coiled-coil domain-containing protein 44) (Translational activator of mitochondrially-encoded cytochrome c oxidase I) | EBI-27030072 | 0.35 |
P12694 | 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain) (BCKDE1A) (BCKDH E1-alpha) | EBI-27030072 | 0.35 |
O75191 | Xylulose kinase (Xylulokinase) (EC 2.7.1.17) | EBI-27030072 | 0.35 |
O60812 | Heterogeneous nuclear ribonucleoprotein C-like 1 (hnRNP C-like-1) (hnRNP core protein C-like 1) | EBI-27030072 | 0.35 |
O75179 | Ankyrin repeat domain-containing protein 17 (Gene trap ankyrin repeat protein) (Serologically defined breast cancer antigen NY-BR-16) | EBI-27030072 | 0.35 |
Q9NUL3 | Double-stranded RNA-binding protein Staufen homolog 2 | EBI-27030072 | 0.52 |
P21281 | V-type proton ATPase subunit B, brain isoform (V-ATPase subunit B 2) (Endomembrane proton pump 58 kDa subunit) (HO57) (Vacuolar proton pump subunit B 2) | EBI-27030072 | 0.52 |
Q9P2K6 | Kelch-like protein 42 (Cullin-3-binding protein 9) (Ctb9) (Kelch domain-containing protein 5) | EBI-27030072 | 0.35 |
Q8IYQ7 | Threonine synthase-like 1 (TSH1) | EBI-27030072 | 0.35 |
Q6P5R6 | 60S ribosomal protein L22-like 1 (Large ribosomal subunit protein eL22-like 1) | EBI-27030072 | 0.35 |
O94761 | ATP-dependent DNA helicase Q4 (EC 3.6.4.12) (DNA helicase, RecQ-like type 4) (RecQ4) (RTS) (RecQ protein-like 4) | EBI-27030072 | 0.35 |
O75915 | PRA1 family protein 3 (ADP-ribosylation factor-like protein 6-interacting protein 5) (ARL-6-interacting protein 5) (Aip-5) (Cytoskeleton-related vitamin A-responsive protein) (Dermal papilla-derived protein 11) (GTRAP3-18) (Glutamate transporter EAAC1-interacting protein) (JM5) (Prenylated Rab acceptor protein 2) (Protein JWa) (Putative MAPK-activating protein PM27) | EBI-27030072 | 0.35 |
O95985 | DNA topoisomerase 3-beta-1 (EC 5.6.2.1) (DNA topoisomerase III beta-1) | EBI-27030072 | 0.35 |
P40222 | Alpha-taxilin | EBI-27030072 | 0.35 |
O14727 | Apoptotic protease-activating factor 1 (APAF-1) | EBI-27030072 | 0.35 |
Q13888 | General transcription factor IIH subunit 2 (Basic transcription factor 2 44 kDa subunit) (BTF2 p44) (General transcription factor IIH polypeptide 2) (TFIIH basal transcription factor complex p44 subunit) | EBI-27030072 | 0.35 |
Q9Y4L1 | Hypoxia up-regulated protein 1 (150 kDa oxygen-regulated protein) (ORP-150) (170 kDa glucose-regulated protein) (GRP-170) | EBI-27030072 | 0.35 |
Q9NX46 | ADP-ribosylhydrolase ARH3 (ADP-ribose glycohydrolase ARH3) (ADP-ribosylhydrolase 3) (O-acetyl-ADP-ribose deacetylase ARH3) (EC 3.5.1.-) (Poly(ADP-ribose) glycohydrolase ARH3) (EC 3.2.1.143) ([Protein ADP-ribosylarginine] hydrolase-like protein 2) ([Protein ADP-ribosylserine] hydrolase) (EC 3.2.2.-) | EBI-27030072 | 0.35 |
P12883 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain, cardiac muscle beta isoform) (MyHC-beta) | EBI-27030072 | 0.35 |
P22681 | E3 ubiquitin-protein ligase CBL (EC 2.3.2.27) (Casitas B-lineage lymphoma proto-oncogene) (Proto-oncogene c-Cbl) (RING finger protein 55) (RING-type E3 ubiquitin transferase CBL) (Signal transduction protein CBL) | EBI-27030072 | 0.35 |
Q16629 | Serine/arginine-rich splicing factor 7 (Splicing factor 9G8) (Splicing factor, arginine/serine-rich 7) | EBI-27030072 | 0.35 |
Q9BTE3 | Mini-chromosome maintenance complex-binding protein (MCM-BP) (MCM-binding protein) | EBI-27030072 | 0.35 |
Q8IXB1 | DnaJ homolog subfamily C member 10 (EC 1.8.4.-) (Endoplasmic reticulum DNA J domain-containing protein 5) (ER-resident protein ERdj5) (ERdj5) (Macrothioredoxin) (MTHr) | EBI-27030072 | 0.35 |
Q53H12 | Acylglycerol kinase, mitochondrial (hAGK) (EC 2.7.1.107) (EC 2.7.1.138) (EC 2.7.1.94) (Multiple substrate lipid kinase) (HsMuLK) (MuLK) (Multi-substrate lipid kinase) | EBI-27030072 | 0.35 |
Q6PJT7 | Zinc finger CCCH domain-containing protein 14 (Mammalian suppressor of tau pathology-2) (MSUT-2) (Renal carcinoma antigen NY-REN-37) | EBI-27030072 | 0.35 |
Q16630 | Cleavage and polyadenylation specificity factor subunit 6 (Cleavage and polyadenylation specificity factor 68 kDa subunit) (CPSF 68 kDa subunit) (Cleavage factor Im complex 68 kDa subunit) (CFIm68) (Pre-mRNA cleavage factor Im 68 kDa subunit) (Protein HPBRII-4/7) | EBI-27030072 | 0.35 |
P04083 | Annexin A1 (Annexin I) (Annexin-1) (Calpactin II) (Calpactin-2) (Chromobindin-9) (Lipocortin I) (Phospholipase A2 inhibitory protein) (p35) [Cleaved into: Annexin Ac2-26] | EBI-27030072 | 0.35 |
P50750 | Cyclin-dependent kinase 9 (EC 2.7.11.22) (EC 2.7.11.23) (C-2K) (Cell division cycle 2-like protein kinase 4) (Cell division protein kinase 9) (Serine/threonine-protein kinase PITALRE) (Tat-associated kinase complex catalytic subunit) | EBI-27030072 | 0.35 |
Q9Y2R9 | 28S ribosomal protein S7, mitochondrial (MRP-S7) (S7mt) (Mitochondrial small ribosomal subunit protein uS7m) (bMRP-27a) (bMRP27a) | EBI-27030072 | 0.35 |
Q96Q05 | Trafficking protein particle complex subunit 9 (NIK- and IKBKB-binding protein) (Tularik gene 1 protein) | EBI-27030072 | 0.35 |
P00750 | Tissue-type plasminogen activator (t-PA) (t-plasminogen activator) (tPA) (EC 3.4.21.68) (Alteplase) (Reteplase) [Cleaved into: Tissue-type plasminogen activator chain A; Tissue-type plasminogen activator chain B] | EBI-27030072 | 0.35 |
Q9Y3X0 | Coiled-coil domain-containing protein 9 | EBI-27030072 | 0.35 |
Q96P48 | Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 (Centaurin-delta-2) (Cnt-d2) | EBI-27030072 | 0.35 |
Q12792 | Twinfilin-1 (Protein A6) (Protein tyrosine kinase 9) | EBI-27030072 | 0.35 |
Q13395 | Probable methyltransferase TARBP1 (EC 2.1.1.-) (TAR RNA-binding protein 1) (TAR RNA-binding protein of 185 kDa) (TRP-185) | EBI-27030072 | 0.35 |
Q13232 | Nucleoside diphosphate kinase 3 (NDK 3) (NDP kinase 3) (EC 2.7.4.6) (DR-nm23) (Nucleoside diphosphate kinase C) (NDPKC) (nm23-H3) | EBI-27030072 | 0.35 |
Q9HAQ2 | Kinesin-like protein KIF9 | EBI-27050247 | 0.35 |
O00571 | ATP-dependent RNA helicase DDX3X (EC 3.6.4.13) (CAP-Rf) (DEAD box protein 3, X-chromosomal) (DEAD box, X isoform) (DBX) (Helicase-like protein 2) (HLP2) | EBI-27050247 | 0.35 |
P42336 | Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (PI3-kinase subunit alpha) (PI3K-alpha) (PI3Kalpha) (PtdIns-3-kinase subunit alpha) (EC 2.7.1.137) (EC 2.7.1.153) (Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha) (PtdIns-3-kinase subunit p110-alpha) (p110alpha) (Phosphoinositide 3-kinase alpha) (Phosphoinositide-3-kinase catalytic alpha polypeptide) (Serine/threonine protein kinase PIK3CA) (EC 2.7.11.1) | EBI-27050247 | 0.35 |
P23193 | Transcription elongation factor A protein 1 (Transcription elongation factor S-II protein 1) (Transcription elongation factor TFIIS.o) | EBI-27050247 | 0.35 |
Q14103 | Heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) (AU-rich element RNA-binding protein 1) | EBI-27050247 | 0.35 |
P23528 | Cofilin-1 (18 kDa phosphoprotein) (p18) (Cofilin, non-muscle isoform) | EBI-27050247 | 0.35 |
P20742 | Pregnancy zone protein (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 6) | EBI-27050247 | 0.35 |
P47929 | Galectin-7 (Gal-7) (HKL-14) (PI7) (p53-induced gene 1 protein) | EBI-27050247 | 0.35 |
P12829 | Myosin light chain 4 (Myosin light chain 1, embryonic muscle/atrial isoform) (Myosin light chain alkali GT-1 isoform) | EBI-27050247 | 0.35 |
Q9Y6K5 | 2'-5'-oligoadenylate synthase 3 ((2-5')oligo(A) synthase 3) (2-5A synthase 3) (EC 2.7.7.84) (p100 OAS) (p100OAS) | EBI-27050631 | 0.35 |
Q9Y3Z3 | Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 (dNTPase) (EC 3.1.5.-) (Dendritic cell-derived IFNG-induced protein) (DCIP) (Monocyte protein 5) (MOP-5) (SAM domain and HD domain-containing protein 1) (hSAMHD1) | EBI-27050631 | 0.35 |
P09913 | Interferon-induced protein with tetratricopeptide repeats 2 (IFIT-2) (ISG-54 K) (Interferon-induced 54 kDa protein) (IFI-54K) (P54) | EBI-27050631 | 0.35 |
P09914 | Interferon-induced protein with tetratricopeptide repeats 1 (IFIT-1) (Interferon-induced 56 kDa protein) (IFI-56K) (P56) | EBI-27050631 | 0.35 |
P33993 | DNA replication licensing factor MCM7 (EC 3.6.4.12) (CDC47 homolog) (P1.1-MCM3) | EBI-27050631 | 0.35 |
P0DTC4 | Envelope small membrane protein (E) (sM protein) | EBI-27052479 | 0.37 |
P0DTC5 | Membrane protein (M) (E1 glycoprotein) (Matrix glycoprotein) (Membrane glycoprotein) | EBI-27052648 | 0.37 |
P35754 | Glutaredoxin-1 (Thioltransferase-1) (TTase-1) | EBI-27072957 | 0.56 |
Q9H307 | Pinin (140 kDa nuclear and cell adhesion-related phosphoprotein) (Desmosome-associated protein) (Domain-rich serine protein) (DRS protein) (DRSP) (Melanoma metastasis clone A protein) (Nuclear protein SDK3) (SR-like protein) | EBI-27092400 | 0.44 |
Q7Z434 | Mitochondrial antiviral-signaling protein (MAVS) (CARD adapter inducing interferon beta) (Cardif) (Interferon beta promoter stimulator protein 1) (IPS-1) (Putative NF-kappa-B-activating protein 031N) (Virus-induced-signaling adapter) (VISA) | EBI-27094247 | 0.54 |
O95786 | Antiviral innate immune response receptor RIG-I (ATP-dependent RNA helicase DDX58) (EC 3.6.4.13) (DEAD box protein 58) (RIG-I-like receptor 1) (RLR-1) (Retinoic acid-inducible gene 1 protein) (RIG-1) (Retinoic acid-inducible gene I protein) (RIG-I) | EBI-27094255 | 0.72 |
O88522 | NF-kappa-B essential modulator (NEMO) (IkB kinase-associated protein 1) (IKKAP1) (mFIP-3) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier) | EBI-27121653 | 0.44 |
Q96C36 | Pyrroline-5-carboxylate reductase 2 (P5C reductase 2) (P5CR 2) (EC 1.5.1.2) | EBI-27126032 | 0.46 |
Q03426 | Mevalonate kinase (MK) (EC 2.7.1.36) | EBI-27126032 | 0.35 |
P32322 | Pyrroline-5-carboxylate reductase 1, mitochondrial (P5C reductase 1) (P5CR 1) (EC 1.5.1.2) | EBI-27126032 | 0.46 |
Q8NEC7 | Glutathione S-transferase C-terminal domain-containing protein | EBI-27126088 | 0.35 |
Q9NX70 | Mediator of RNA polymerase II transcription subunit 29 (Intersex-like protein) (Mediator complex subunit 29) | EBI-27126088 | 0.35 |
P49795 | Regulator of G-protein signaling 19 (RGS19) (G-alpha-interacting protein) (GAIP) | EBI-27126088 | 0.35 |
G9CGD6 | CNK3/IPCEF1 fusion protein | EBI-27126088 | 0.35 |
P23142 | Fibulin-1 (FIBL-1) | EBI-27126088 | 0.35 |
Q9NPH0 | Lysophosphatidic acid phosphatase type 6 (EC 3.1.3.2) (Acid phosphatase 6, lysophosphatidic) (Acid phosphatase-like protein 1) (PACPL1) | EBI-27126088 | 0.35 |
P51687 | Sulfite oxidase, mitochondrial (EC 1.8.3.1) | EBI-27126088 | 0.35 |
Q02952 | A-kinase anchor protein 12 (AKAP-12) (A-kinase anchor protein 250 kDa) (AKAP 250) (Gravin) (Myasthenia gravis autoantigen) | EBI-27126088 | 0.35 |
Q8IVE3 | Pleckstrin homology domain-containing family H member 2 | EBI-27126088 | 0.35 |
Q96AX9 | E3 ubiquitin-protein ligase MIB2 (EC 2.3.2.27) (Mind bomb homolog 2) (Novel zinc finger protein) (Novelzin) (Putative NF-kappa-B-activating protein 002N) (RING-type E3 ubiquitin transferase MIB2) (Skeletrophin) (Zinc finger ZZ type with ankyrin repeat domain protein 1) | EBI-27126088 | 0.35 |
Q9NR28 | Diablo IAP-binding mitochondrial protein (Diablo homolog, mitochondrial) (Direct IAP-binding protein with low pI) (Second mitochondria-derived activator of caspase) (Smac) | EBI-27126088 | 0.35 |
Q15773 | Myeloid leukemia factor 2 (Myelodysplasia-myeloid leukemia factor 2) | EBI-27126088 | 0.35 |
O43149 | Zinc finger ZZ-type and EF-hand domain-containing protein 1 | EBI-27126088 | 0.35 |
Q6DKK2 | Tetratricopeptide repeat protein 19, mitochondrial (TPR repeat protein 19) | EBI-27126088 | 0.35 |
O43447 | Peptidyl-prolyl cis-trans isomerase H (PPIase H) (EC 5.2.1.8) (Rotamase H) (Small nuclear ribonucleoprotein particle-specific cyclophilin H) (CypH) (U-snRNP-associated cyclophilin SnuCyp-20) (USA-CYP) | EBI-27126088 | 0.35 |
P83111 | Serine beta-lactamase-like protein LACTB, mitochondrial (EC 3.4.-.-) | EBI-27126088 | 0.35 |
P81605 | Dermcidin (EC 3.4.-.-) (Preproteolysin) [Cleaved into: Survival-promoting peptide; DCD-1] | EBI-27126148 | 0.40 |
P10809 | 60 kDa heat shock protein, mitochondrial (EC 5.6.1.7) (60 kDa chaperonin) (Chaperonin 60) (CPN60) (Heat shock protein 60) (HSP-60) (Hsp60) (HuCHA60) (Mitochondrial matrix protein P1) (P60 lymphocyte protein) | EBI-27126652 | 0.40 |
P68363 | Tubulin alpha-1B chain (EC 3.6.5.-) (Alpha-tubulin ubiquitous) (Tubulin K-alpha-1) (Tubulin alpha-ubiquitous chain) [Cleaved into: Detyrosinated tubulin alpha-1B chain] | EBI-27126663 | 0.40 |
P21108 | Ribose-phosphate pyrophosphokinase 3 (EC 2.7.6.1) (Phosphoribosyl pyrophosphate synthase 1-like 1) (PRPS1-like 1) (Phosphoribosyl pyrophosphate synthase III) (PRS-III) | EBI-27126674 | 0.40 |
Q99558 | Mitogen-activated protein kinase kinase kinase 14 (EC 2.7.11.25) (NF-kappa-beta-inducing kinase) (HsNIK) (Serine/threonine-protein kinase NIK) | EBI-27126696 | 0.40 |
Q96AY3 | Peptidyl-prolyl cis-trans isomerase FKBP10 (PPIase FKBP10) (EC 5.2.1.8) (65 kDa FK506-binding protein) (65 kDa FKBP) (FKBP-65) (FK506-binding protein 10) (FKBP-10) (Immunophilin FKBP65) (Rotamase) | EBI-27126707 | 0.35 |
Q9NQH7 | Xaa-Pro aminopeptidase 3 (X-Pro aminopeptidase 3) (EC 3.4.11.9) (Aminopeptidase P3) (APP3) | EBI-27126707 | 0.35 |
P48594 | Serpin B4 (Leupin) (Peptidase inhibitor 11) (PI-11) (Squamous cell carcinoma antigen 2) (SCCA-2) | EBI-27126721 | 0.40 |
P51784 | Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.4.19.12) (Deubiquitinating enzyme 11) (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) | EBI-27126732 | 0.35 |
Q5W0V3 | FHF complex subunit HOOK interacting protein 2A (FHIP2A) | EBI-27126745 | 0.35 |
Q9HD23 | Magnesium transporter MRS2 homolog, mitochondrial (MRS2-like protein) | EBI-27126745 | 0.35 |
O94830 | Phospholipase DDHD2 (EC 3.1.1.-) (DDHD domain-containing protein 2) (KIAA0725p) (SAM, WWE and DDHD domain-containing protein 1) | EBI-27126745 | 0.35 |
Q9UQ90 | Paraplegin (EC 3.4.24.-) (Cell matrix adhesion regulator) (Spastic paraplegia 7 protein) | EBI-27126745 | 0.35 |
Q12979 | Active breakpoint cluster region-related protein | EBI-27126745 | 0.35 |
Q15021 | Condensin complex subunit 1 (Chromosome condensation-related SMC-associated protein 1) (Chromosome-associated protein D2) (hCAP-D2) (Non-SMC condensin I complex subunit D2) (XCAP-D2 homolog) | EBI-27126745 | 0.35 |
O60512 | Beta-1,4-galactosyltransferase 3 (Beta-1,4-GalTase 3) (Beta4Gal-T3) (b4Gal-T3) (EC 2.4.1.-) (Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase) (Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase) (EC 2.4.1.38) (N-acetyllactosamine synthase) (EC 2.4.1.90) (Nal synthase) (Neolactotriaosylceramide beta-1,4-galactosyltransferase) (EC 2.4.1.275) (UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 3) (UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 3) | EBI-27126745 | 0.35 |
Q9HB07 | MYG1 exonuclease (EC 3.1.-.-) | EBI-27126745 | 0.35 |
Q9H920 | RING finger protein 121 | EBI-27126745 | 0.35 |
Q9HCN3 | Post-GPI attachment to proteins factor 6 (EC 3.1.1.4) (GPI processing phospholipase A2) (GPI-PLA2) (Protein M83) (Transmembrane protein 6) (Transmembrane protein 8) (Transmembrane protein 8A) | EBI-27126745 | 0.35 |
Q96NR8 | Retinol dehydrogenase 12 (EC 1.1.1.300) (All-trans and 9-cis retinol dehydrogenase) (Short chain dehydrogenase/reductase family 7C member 2) | EBI-27126745 | 0.35 |
Q8IUH4 | Palmitoyltransferase ZDHHC13 (EC 2.3.1.225) (Huntingtin-interacting protein 14-related protein) (HIP14-related protein) (Huntingtin-interacting protein HIP3RP) (Putative MAPK-activating protein PM03) (Putative NF-kappa-B-activating protein 209) (Zinc finger DHHC domain-containing protein 13) (DHHC-13) | EBI-27126745 | 0.35 |
Q9BUJ0 | Protein ABHD14A (EC 3.-.-.-) (Alpha/beta hydrolase domain-containing protein 14A) (Abhydrolase domain-containing protein 14A) | EBI-27126745 | 0.35 |
Q86WT1 | Tetratricopeptide repeat protein 30A (TPR repeat protein 30A) | EBI-27126745 | 0.35 |
P04920 | Anion exchange protein 2 (AE 2) (Anion exchanger 2) (Non-erythroid band 3-like protein) (BND3L) (Solute carrier family 4 member 2) | EBI-27126745 | 0.35 |
Q9Y375 | Complex I intermediate-associated protein 30, mitochondrial (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 1) | EBI-27126745 | 0.35 |
Q06323 | Proteasome activator complex subunit 1 (11S regulator complex subunit alpha) (REG-alpha) (Activator of multicatalytic protease subunit 1) (Interferon gamma up-regulated I-5111 protein) (IGUP I-5111) (Proteasome activator 28 subunit alpha) (PA28a) (PA28alpha) | EBI-27126745 | 0.35 |
Q9ULF5 | Zinc transporter ZIP10 (Solute carrier family 39 member 10) (Zrt- and Irt-like protein 10) (ZIP-10) | EBI-27126745 | 0.35 |
Q9UJJ9 | N-acetylglucosamine-1-phosphotransferase subunit gamma (GlcNAc-1-phosphotransferase subunit gamma) (UDP-N-acetylglucosamine-1-phosphotransferase subunit gamma) | EBI-27126745 | 0.35 |
P18859 | ATP synthase-coupling factor 6, mitochondrial (ATPase subunit F6) (ATP synthase peripheral stalk subunit F6) | EBI-27126745 | 0.35 |
Q9NRY5 | Protein FAM114A2 | EBI-27126745 | 0.35 |
Q9NPA0 | ER membrane protein complex subunit 7 | EBI-27126745 | 0.35 |
Q7L7V1 | Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 (EC 3.6.4.13) (DEAD/H box 32) (DEAD/H helicase-like protein 1) (DHLP1) (DEAH box protein 32) (HuDDX32) | EBI-27126745 | 0.35 |
Q3T906 | N-acetylglucosamine-1-phosphotransferase subunits alpha/beta (EC 2.7.8.17) (GlcNAc-1-phosphotransferase subunits alpha/beta) (Stealth protein GNPTAB) (UDP-N-acetylglucosamine-1-phosphotransferase subunits alpha/beta) [Cleaved into: N-acetylglucosamine-1-phosphotransferase subunit alpha; N-acetylglucosamine-1-phosphotransferase subunit beta] | EBI-27126745 | 0.35 |
O95873 | Uncharacterized protein C6orf47 (Protein G4) | EBI-27126745 | 0.35 |
Q9C0C2 | 182 kDa tankyrase-1-binding protein | EBI-27126939 | 0.35 |
A5YKK6 | CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) | EBI-27126939 | 0.35 |
Q96LI5 | CCR4-NOT transcription complex subunit 6-like (EC 3.1.13.4) (Carbon catabolite repressor protein 4 homolog B) | EBI-27126939 | 0.35 |
Q96FV9 | THO complex subunit 1 (Tho1) (Nuclear matrix protein p84) (p84N5) (hTREX84) | EBI-27126939 | 0.35 |
O14640 | Segment polarity protein dishevelled homolog DVL-1 (Dishevelled-1) (DSH homolog 1) | EBI-27126939 | 0.35 |
Q9H1K0 | Rabenosyn-5 (110 kDa protein) (FYVE finger-containing Rab5 effector protein rabenosyn-5) (RAB effector RBSN) (Zinc finger FYVE domain-containing protein 20) | EBI-27126939 | 0.35 |
A6NHR9 | Structural maintenance of chromosomes flexible hinge domain-containing protein 1 (SMC hinge domain-containing protein 1) (EC 3.6.1.-) | EBI-27126939 | 0.35 |
Q92997 | Segment polarity protein dishevelled homolog DVL-3 (Dishevelled-3) (DSH homolog 3) | EBI-27126939 | 0.35 |
Q9UNZ2 | NSFL1 cofactor p47 (UBX domain-containing protein 2C) (p97 cofactor p47) | EBI-27126939 | 0.35 |
Q9NZN8 | CCR4-NOT transcription complex subunit 2 (CCR4-associated factor 2) | EBI-27126939 | 0.35 |
O75175 | CCR4-NOT transcription complex subunit 3 (CCR4-associated factor 3) (Leukocyte receptor cluster member 2) | EBI-27126939 | 0.35 |
O43432 | Eukaryotic translation initiation factor 4 gamma 3 (eIF-4-gamma 3) (eIF-4G 3) (eIF4G 3) (eIF-4-gamma II) (eIF4GII) | EBI-27126939 | 0.35 |
Q5W0B1 | ORC ubiquitin ligase 1 (OBI1) (EC 2.3.2.27) (RING finger protein 219) | EBI-27126939 | 0.35 |
O14641 | Segment polarity protein dishevelled homolog DVL-2 (Dishevelled-2) (DSH homolog 2) | EBI-27126939 | 0.35 |
Q86W42 | THO complex subunit 6 homolog (Functional spliceosome-associated protein 35) (fSAP35) (WD repeat-containing protein 58) | EBI-27126939 | 0.35 |
Q7Z478 | ATP-dependent RNA helicase DHX29 (EC 3.6.4.13) (DEAH box protein 29) (Nucleic acid helicase DDXx) | EBI-27126939 | 0.35 |
P63208 | S-phase kinase-associated protein 1 (Cyclin-A/CDK2-associated protein p19) (p19A) (Organ of Corti protein 2) (OCP-2) (Organ of Corti protein II) (OCP-II) (RNA polymerase II elongation factor-like protein) (SIII) (Transcription elongation factor B polypeptide 1-like) (p19skp1) | EBI-27127026 | 0.35 |
Q6FI81 | Anamorsin (Cytokine-induced apoptosis inhibitor 1) (Fe-S cluster assembly protein DRE2 homolog) | EBI-27127026 | 0.35 |
O76003 | Glutaredoxin-3 (PKC-interacting cousin of thioredoxin) (PICOT) (PKC-theta-interacting protein) (PKCq-interacting protein) (Thioredoxin-like protein 2) | EBI-27127026 | 0.35 |
Q6PEY2 | Tubulin alpha-3E chain (EC 3.6.5.-) (Alpha-tubulin 3E) [Cleaved into: Detyrosinated tubulin alpha-3E chain] | EBI-27128059 | 0.27 |
Q8NHA4 | Olfactory receptor 2AE1 (Olfactory receptor 2AE2) | EBI-27128073 | 0.27 |
P17661 | Desmin | EBI-27128105 | 0.27 |
P30086 | Phosphatidylethanolamine-binding protein 1 (PEBP-1) (HCNPpp) (Neuropolypeptide h3) (Prostatic-binding protein) (Raf kinase inhibitor protein) (RKIP) [Cleaved into: Hippocampal cholinergic neurostimulating peptide (HCNP)] | EBI-27128112 | 0.27 |
O15143 | Actin-related protein 2/3 complex subunit 1B (Arp2/3 complex 41 kDa subunit) (p41-ARC) | EBI-27128112 | 0.27 |
P08758 | Annexin A5 (Anchorin CII) (Annexin V) (Annexin-5) (Calphobindin I) (CPB-I) (Endonexin II) (Lipocortin V) (Placental anticoagulant protein 4) (PP4) (Placental anticoagulant protein I) (PAP-I) (Thromboplastin inhibitor) (Vascular anticoagulant-alpha) (VAC-alpha) | EBI-27128112 | 0.27 |
Q5TFE4 | 5'-nucleotidase domain-containing protein 1 (EC 3.1.3.-) | EBI-27128112 | 0.27 |
P08133 | Annexin A6 (67 kDa calelectrin) (Annexin VI) (Annexin-6) (Calphobindin-II) (CPB-II) (Chromobindin-20) (Lipocortin VI) (Protein III) (p68) (p70) | EBI-27128112 | 0.27 |
O75367 | Core histone macro-H2A.1 (Histone macroH2A1) (mH2A1) (Histone H2A.y) (H2A/y) (Medulloblastoma antigen MU-MB-50.205) | EBI-27128132 | 0.27 |
Q9NRL2 | Bromodomain adjacent to zinc finger domain protein 1A (ATP-dependent chromatin-remodeling protein) (ATP-utilizing chromatin assembly and remodeling factor 1) (hACF1) (CHRAC subunit ACF1) (Williams syndrome transcription factor-related chromatin-remodeling factor 180) (WCRF180) (hWALp1) | EBI-27128132 | 0.27 |
Q9Y5B9 | FACT complex subunit SPT16 (Chromatin-specific transcription elongation factor 140 kDa subunit) (FACT 140 kDa subunit) (FACTp140) (Facilitates chromatin transcription complex subunit SPT16) (hSPT16) | EBI-27128132 | 0.27 |
P45973 | Chromobox protein homolog 5 (Antigen p25) (Heterochromatin protein 1 homolog alpha) (HP1 alpha) | EBI-27128476 | 0.35 |
O75475 | PC4 and SFRS1-interacting protein (CLL-associated antigen KW-7) (Dense fine speckles 70 kDa protein) (DFS 70) (Lens epithelium-derived growth factor) (Transcriptional coactivator p75/p52) | EBI-27128132 | 0.27 |
Q13111 | Chromatin assembly factor 1 subunit A (CAF-1 subunit A) (Chromatin assembly factor I p150 subunit) (CAF-I 150 kDa subunit) (CAF-I p150) (hp150) | EBI-27128132 | 0.27 |
P51608 | Methyl-CpG-binding protein 2 (MeCp-2 protein) (MeCp2) | EBI-27128132 | 0.27 |
P51532 | Transcription activator BRG1 (EC 3.6.4.-) (ATP-dependent helicase SMARCA4) (BRG1-associated factor 190A) (BAF190A) (Mitotic growth and transcription activator) (Protein BRG-1) (Protein brahma homolog 1) (SNF2-beta) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4) | EBI-27128132 | 0.27 |
Q9UIG0 | Tyrosine-protein kinase BAZ1B (EC 2.7.10.2) (Bromodomain adjacent to zinc finger domain protein 1B) (Williams syndrome transcription factor) (Williams-Beuren syndrome chromosomal region 10 protein) (Williams-Beuren syndrome chromosomal region 9 protein) (hWALp2) | EBI-27128132 | 0.27 |
Q99986 | Serine/threonine-protein kinase VRK1 (EC 2.7.11.1) (Vaccinia-related kinase 1) | EBI-27128132 | 0.27 |
P35659 | Protein DEK | EBI-27128132 | 0.27 |
Q08945 | FACT complex subunit SSRP1 (Chromatin-specific transcription elongation factor 80 kDa subunit) (Facilitates chromatin transcription complex 80 kDa subunit) (FACT 80 kDa subunit) (FACTp80) (Facilitates chromatin transcription complex subunit SSRP1) (Recombination signal sequence recognition protein 1) (Structure-specific recognition protein 1) (hSSRP1) (T160) | EBI-27128132 | 0.27 |
Q03518 | Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4) | EBI-27128155 | 0.27 |
Q14676 | Mediator of DNA damage checkpoint protein 1 (Nuclear factor with BRCT domains 1) | EBI-27128162 | 0.27 |
P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | EBI-27128162 | 0.27 |
P00374 | Dihydrofolate reductase (EC 1.5.1.3) | EBI-27128172 | 0.27 |
Q3SXY7 | Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3 | EBI-27128172 | 0.27 |
Q9UK32 | Ribosomal protein S6 kinase alpha-6 (S6K-alpha-6) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 6) (p90-RSK 6) (p90RSK6) (Ribosomal S6 kinase 4) (RSK-4) (pp90RSK4) | EBI-27128172 | 0.27 |
Q92771 | Putative ATP-dependent RNA helicase DDX12 (EC 3.6.4.13) (CHL1-related protein 2) (hCHLR2) (DEAD/H box protein 12) | EBI-27128209 | 0.27 |
P59534 | Taste receptor type 2 member 39 (T2R39) (Taste receptor type 2 member 57) (T2R57) | EBI-27128216 | 0.27 |
Q96RG2 | PAS domain-containing serine/threonine-protein kinase (PAS-kinase) (PASKIN) (hPASK) (EC 2.7.11.1) | EBI-27128243 | 0.27 |
Q9H9G7 | Protein argonaute-3 (Argonaute3) (hAgo3) (EC 3.1.26.n2) (Argonaute RISC catalytic component 3) (Eukaryotic translation initiation factor 2C 3) (eIF-2C 3) (eIF2C 3) | EBI-27128476 | 0.35 |
Q93008 | Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC 3.4.19.12) (Deubiquitinating enzyme FAF-X) (Fat facets in mammals) (hFAM) (Fat facets protein-related, X-linked) (Ubiquitin thioesterase FAF-X) (Ubiquitin-specific protease 9, X chromosome) (Ubiquitin-specific-processing protease FAF-X) | EBI-27128476 | 0.35 |
Q9HA64 | Ketosamine-3-kinase (EC 2.7.1.172) (Fructosamine-3-kinase-related protein) (FN3K-RP) (FN3K-related protein) (Protein-psicosamine 3-kinase FN3KRP) (EC 2.7.1.-) | EBI-27128476 | 0.35 |
Q13889 | General transcription factor IIH subunit 3 (Basic transcription factor 2 34 kDa subunit) (BTF2 p34) (General transcription factor IIH polypeptide 3) (TFIIH basal transcription factor complex p34 subunit) | EBI-27128476 | 0.35 |
A3KMH1 | von Willebrand factor A domain-containing protein 8 (PEX7-binding protein 2) (P7BP2) | EBI-27128476 | 0.35 |
Q2NKX8 | DNA excision repair protein ERCC-6-like (EC 3.6.4.12) (ATP-dependent helicase ERCC6-like) (PLK1-interacting checkpoint helicase) (Tumor antigen BJ-HCC-15) | EBI-27128476 | 0.35 |
P45974 | Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.4.19.12) (Deubiquitinating enzyme 5) (Isopeptidase T) (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) | EBI-27128476 | 0.35 |
Q15418 | Ribosomal protein S6 kinase alpha-1 (S6K-alpha-1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (p90RSK1) (p90S6K) (MAP kinase-activated protein kinase 1a) (MAPK-activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK-1a) (Ribosomal S6 kinase 1) (RSK-1) | EBI-27128476 | 0.35 |
Q9UKK9 | ADP-sugar pyrophosphatase (EC 3.6.1.13) (8-oxo-dGDP phosphatase) (EC 3.6.1.58) (Nuclear ATP-synthesis protein NUDIX5) (EC 2.7.7.96) (Nucleoside diphosphate-linked moiety X motif 5) (Nudix motif 5) (hNUDT5) (YSA1H) | EBI-27128476 | 0.35 |
Q14008 | Cytoskeleton-associated protein 5 (Colonic and hepatic tumor overexpressed gene protein) (Ch-TOG) | EBI-27128476 | 0.35 |
O95071 | E3 ubiquitin-protein ligase UBR5 (EC 2.3.2.26) (E3 ubiquitin-protein ligase, HECT domain-containing 1) (HECT-type E3 ubiquitin transferase UBR5) (Hyperplastic discs protein homolog) (hHYD) (Progestin-induced protein) | EBI-27128476 | 0.35 |
P31948 | Stress-induced-phosphoprotein 1 (STI1) (Hsc70/Hsp90-organizing protein) (Hop) (Renal carcinoma antigen NY-REN-11) (Transformation-sensitive protein IEF SSP 3521) | EBI-27128476 | 0.35 |
Q7Z4H7 | HAUS augmin-like complex subunit 6 | EBI-27128476 | 0.35 |
P78344 | Eukaryotic translation initiation factor 4 gamma 2 (eIF-4-gamma 2) (eIF-4G 2) (eIF4G 2) (Death-associated protein 5) (DAP-5) (p97) | EBI-27128476 | 0.35 |
Q00987 | E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2) | EBI-30810800 | 0.40 |
Q13283 | Ras GTPase-activating protein-binding protein 1 (G3BP-1) (EC 3.6.4.12) (EC 3.6.4.13) (ATP-dependent DNA helicase VIII) (hDH VIII) (GAP SH3 domain-binding protein 1) | EBI-30814306 | 0.57 |